Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 6.8e-14
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 6.8e-14

AA Sequence

MENPRCPRRPLAEKKARSLDRPQAPGKGSESWDCHWLSLPTAPSRKALHWTTSDWARHSDSPAPSAEAHC      1 - 70
TTAAAPTPEETGDFLPSEQRPSQDTKKGWLKTMLNFFVRTGPEEPREKASRRPRGKEGISQHPEPLEAAG     71 - 140
EPALRKKAHHDKKPSRKKQGHKKHAAEVTKAAQDQEARGREEGLSKAAAALRSGEADLGPARRGGEDSDH    141 - 210
QSFLIKVDGTGALDVSPHATGHQQEEELKKPDQDAIIQMIVELLKRVGDQWEEEQSLASQLGVALPNPAP    211 - 280
AVRKKSQEKKTSLKRTSKTNPKKHGSEEAKRGAADVSSPEAWPPKKSSFLPLCVSGHRPSISSSYGLEEP    281 - 350
KVQEAPSTEAGAPGPSVLPTPSESQEPGEELPLDRASEYKEFIQKIISMLQDAEEQQGEEQPQVQQEEVG    351 - 420
VENPAPHCRRKSQEKRSSFRRAFYHKKHTSKEPRRAGAAGAASPEARRPKRPSFLPLCVGGHRPSTSSSL    421 - 490
DPEDLECREPLPAEGEPVVISEAPSQARGHTPEGAPQLSGACESKEIIIQKLVALLQEVDGQLGQQIRRH    491 - 560
PSFKRFFYEFSDSSLSKLVATLRSQVAHSSKLDRNRARRLYQFDVSLANKFAGSNSHAMCILMGLRDHYN    561 - 630
CTQFPYREDQPNITSPKVESPD                                                    631 - 652
//

Text Mined References (6)

PMID Year Title