Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.2e-03

Expression

AA Sequence

MEEAILLNQTSLVTYFRLRGLSVNHKARIAMFSMFLIFYVLTLIGNVLIVITIIYDHRLHTPMYFFLSNL      1 - 70
SFIDVCHSTVTVPKMLRDVWSEEKLISFDACVTQMFFLHLFACTEIFLLTVMAYDRYVAICKPLQYMIVM     71 - 140
NWKVCVLLAVALWTGGTIHSIALTSLTIKLPYCGPDEIDNFFCDVPQVIKLACIDTPYVLEILIVSNSGL    141 - 210
ISVVCFVVLVVSYAVILVSLRQQISKGKWKALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKAVSVFF    211 - 280
TAVTPLLNPIIYTLRNEEMKSALNKLVGRKERKEEK                                      281 - 316
//

Text Mined References (5)

PMID Year Title