Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MPRPNFMAVTEFTFEGFSIFEWHHRLILFVIFLVLYVLTLASNAIILIVIRLNHQLHTPMYFFLSVLSIS      1 - 70
ETYYTVAINPQMLSGLLSPQQTISIPGCAAQLFFYLTFGVNKCFLLTAMGYDHYVAICNPLQYSVIMGKK     71 - 140
ACIQLVSGSWNIGLSTAIIQVSSVFSLPFCDANLISHFFCDIRPIMKLACADTTIKEIITLLISLCVLVL    141 - 210
PMVLIFISYVLIVTTILKIASAEGRRKAFATCASHLTVVIVHYGRTSFIYLKPKSQNSLQDRLISVTYTV    211 - 280
ITPLLNPVVYSLRNKEVKDALLRALGRKPLS                                           281 - 311
//

Text Mined References (3)

PMID Year Title
17973576 2007 Genetic elucidation of human hyperosmia to isovaleric acid.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.