Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MEDKNQTVVTEFLLLGLTDHPYQKIVLFFMFLFVYLITLGGNLGMITLIWIDPRLHTPMYFFLRHLSFVD      1 - 70
ICSSSSVVPKMLCNIFAEKKDITFLGCAAQMWFFGLFEAAECFLLAAMAYDRYVAICKPLLYTLIMSQQV     71 - 140
CMQLVVGPYAMALISTMTHTIFTFCLPFCGSNIINHFFCDIFPLLSLACADTWVNKFVLFVLAGAIGVLS    141 - 210
GLIIMVSYICILMTILKIQTADGKQKAFFTCFSHLAAVSILYGTLFLIYVRPSSSSSLGIYKVISLFYTV    211 - 280
VIPMVNPLIYSLRNKEVKDAFRRKIERKKFIIGR                                        281 - 314
//

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12730696 2003 Different noses for different people.