Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MDKNQTEVMREFFLSGFSQTPSIEAGLFVLFLFFYMSIWVGNVLIMVTVASDKYLNSSPMYFLLGNLSFL      1 - 70
DLCYSTVTTPKLLADFFNHEKLISYDQCIVQLFFLHFVGAAEMFLLTVMAYDRYVAICRPLHYTTVMSRG     71 - 140
LCCVLVAASWMGGFVHSTVQTILTVHLPFCGPNQVENFFCDVPPVIKLACADTFVIELLMVSNSGLISTI    141 - 210
SFVVLISSYTTILVKIRSKEGRRKALSTCASHLMVVTLFFGPCIFIYARPFSTFSVDKMVSVLYNVITPM    211 - 280
LNPLIYTLRNKEVKSAMQKLWVRNGLTWKKQET                                         281 - 313
//

Text Mined References (3)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12730696 2003 Different noses for different people.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.