Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.71
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

Synonym

Accession P0C5Y4 A6NJ92
Symbols KAP1.4
KRTAP1.4

Gene

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
12228244 no polymorphic alleles were found for the hKAP1.4 and hKAP1.5 genes in Japanese and Caucasian individuals

AA Sequence

MASCSTSGTCGSSCCQPSCCETSCCQPSCCQTSSCGTGCGIGGGIGYGQEGSGGSVSTRIRWCHPDCHVE      1 - 70
GTCLPPCYLVSCTPPSCCQLHHAEASCCRPSYCGQSCCRPACCCHCCEPTC                        71 - 121
//

Text Mined References (3)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
12228244 2002 Polymorphisms in the human high sulfur hair keratin-associated protein 1, KAP1, gene family.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.