Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.71
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
psoriasis 6694 2.2e-03

Gene RIF (1)

AA Sequence

MASCSTSGTCGSSCCQPSCCETSCCQPSCCQTSSCGTGCGIGGGIGYGQEGSGGSVSTRIRWCHPDCHVE      1 - 70
GTCLPPCYLVSCTPPSCCQLHHAEASCCRPSYCGQSCCRPACCCHCCEPTC                        71 - 121
//

Text Mined References (3)

PMID Year Title