Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.0e-36

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.300 2.0e-36

AA Sequence

MMHTTSYRRLSPPHLTDQPSAYSHTHRTFSHFSCGSQPAAQRLHVELWNADLQSEFLCPCLGLTLYLTCN      1 - 70
PQLGKRKFCSHSSEDMSKMVSRRNVKDSHEVSGSLQATLQVISFSFPFLLHTCSHPLSHPTSGQRR         71 - 136
//

Text Mined References (4)

PMID Year Title
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
15905330 2005 Identification of cancer/testis-antigen genes by massively parallel signature sequencing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.