Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C5K6
Symbols CT18
NA88A
VENTX2P1

Gene

 Compartment GO Term (0)

AA Sequence

MSPPSSMCSPVPLLAAASGQNRMTQGQHFLQKV                                           1 - 33
//

Text Mined References (3)

PMID Year Title
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
11549314 2001 Molecular cloning of a human Vent-like homeobox gene.
10790436 2000 A processed pseudogene codes for a new antigen recognized by a CD8(+) T cell clone on melanoma.