Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
19718026 Identifies FAM86B2 as being one of 30 genes with the most variable copy numbers in three human genomes.

AA Sequence

MAPEENAGTELLLQGFERRFLAVRTLRSFPWQSLEAKLRDSSDSELLRDILQKTVRHPVCVKHPPSVKYA      1 - 70
WCFLSELIKKHEAVHTEPLDKLYEVLAETLMAKESTQGHRSYLLSSGGSVTLSKSTAIISHGTTGLVTWD     71 - 140
AALYLAEWAIENPAAFINRTVLELGSGAGLTGLAICKMCRPRAYIFSDPHSRILEQLRGNVLLNGLSLEA    141 - 210
DITGNLDSPRVTVAQLDWDVAMVHQLSAFQPDVVIAADVLYCPEAIVSLVGVLQRLAACREHKRAPEVYV    211 - 280
AFTVRNPETCQLFTTELGRDGIRWEAEAHHDQKLFPYGEHLEMAMLNLTL                        281 - 330
//

Text Mined References (3)

PMID Year Title
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
19718026 2009 Personalized copy number and segmental duplication maps using next-generation sequencing.
16421571 2006 DNA sequence and analysis of human chromosome 8.