Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C2W7 A6NM97
Symbols CT47.13
CT47A13

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Cow OMA Inparanoid

 Compartment GO Term (0)

AA Sequence

MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDMVPAAEVVGVAGPVEGLGEEEGEQAA      1 - 70
GLAAVPQGGSAEEDSDIGPATEEEEEEEEGNEAANFDLAVATRRYPAAGIGFVFLYLVHSLLRRLYHNDH     71 - 140
IQIANRHLSRLMVGPHAAVPNLWDNPPLLLLSQRLGAGAAAPEGEGLGLIQEAASVQEAASVPEPAVPAD    141 - 210
LAEMAREPAEEAADEKPPEEAAEEKLTEEATEEPAAEEPTSEEAVAPEEVTKSQPEKWDEEAQDAAGEEE    211 - 280
KEQEKEKDVENKVKNSKGT                                                       281 - 299
//

Text Mined References (3)

PMID Year Title
23092983 2012 Analysis of the chromosome X exome in patients with autism spectrum disorders identified novel candidate genes, including TMLHE.
16382448 2006 Identification of a new cancer/testis gene family, CT47, among expressed multicopy genes on the human X chromosome.
15772651 2005 The DNA sequence of the human X chromosome.