Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C2W7 A6NM97
Symbols CT47.13
CT47A13

Gene

 Compartment GO Term (0)

AA Sequence

MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDMVPAAEVVGVAGPVEGLGEEEGEQAA      1 - 70
GLAAVPQGGSAEEDSDIGPATEEEEEEEEGNEAANFDLAVATRRYPAAGIGFVFLYLVHSLLRRLYHNDH     71 - 140
IQIANRHLSRLMVGPHAAVPNLWDNPPLLLLSQRLGAGAAAPEGEGLGLIQEAASVQEAASVPEPAVPAD    141 - 210
LAEMAREPAEEAADEKPPEEAAEEKLTEEATEEPAAEEPTSEEAVAPEEVTKSQPEKWDEEAQDAAGEEE    211 - 280
KEQEKEKDVENKVKNSKGT                                                       281 - 299
//

Text Mined References (3)

PMID Year Title
23092983 2012 Analysis of the chromosome X exome in patients with autism spectrum disorders identified novel candidate genes, including TMLHE.
16382448 2006 Identification of a new cancer/testis gene family, CT47, among expressed multicopy genes on the human X chromosome.
15772651 2005 The DNA sequence of the human X chromosome.