Property Summary

NCBI Gene PubMed Count 7
PubMed Score 10.27
PubTator Score 7.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.400 4.5e-05
astrocytic glioma -1.500 9.3e-03
Astrocytoma, Pilocytic -1.200 2.3e-05
atypical teratoid / rhabdoid tumor -1.100 2.0e-03
Breast cancer 1.100 1.1e-11
ependymoma -1.700 9.4e-03
gastric carcinoma 1.200 2.2e-02
glioblastoma -1.100 2.1e-03
intraductal papillary-mucinous carcinoma... 1.200 3.7e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.7e-03
medulloblastoma -1.100 6.2e-04
medulloblastoma, large-cell -1.400 5.1e-06
non-small cell lung cancer 1.490 3.8e-15
oligodendroglioma -1.400 1.4e-02
osteosarcoma 1.240 2.8e-03
ovarian cancer 1.500 1.4e-03
Pick disease 1.900 1.2e-04
psoriasis 1.400 2.6e-35
subependymal giant cell astrocytoma -1.551 3.3e-02

Gene RIF (6)

AA Sequence

MAAPAPGAGAASGGAGCSGGGAGAGAGSGSGAAGAGGRLPSRVLELVFSYLELSELRSCALVCKHWYRCL      1 - 70
HGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQS     71 - 140
TDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGE    141 - 210
VNGSFPQCNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYL    211 - 280
GKPLDG                                                                    281 - 286
//

Text Mined References (11)

PMID Year Title