Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.10
PubTator Score 7.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 4.14608468961893E-18
non-small cell lung cancer 2798 3.82190893987677E-15
Breast cancer 3099 1.06248780736135E-11
osteosarcoma 7933 5.35163494586891E-7
pediatric high grade glioma 2712 3.05564312462878E-6
medulloblastoma, large-cell 6234 5.14799412533064E-6
glioblastoma 5572 5.19806202137774E-6
atypical teratoid / rhabdoid tumor 4369 1.02626402755128E-5
pilocytic astrocytoma 3086 1.32526266114068E-5
Pick disease 1893 1.19302065667821E-4
ovarian cancer 8492 0.00144614045471544
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00168127519643699
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00371716316662978
sonic hedgehog group medulloblastoma 1482 0.00390312743973726
subependymal giant cell astrocytoma 2287 0.00467872318256217
astrocytic glioma 2241 0.00926477769523575
ependymoma 2514 0.00941011516979737
oligodendroglioma 2849 0.013621071779324
gastric carcinoma 832 0.0218222017458161

Expression

  Differential Expression (19)

Synonym

Accession P0C2W1 A6NF90 D3DXB5
Symbols Fbx45

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (5)

PMID Text
25460509 Data show that epithelial-mesenchymal transition (EMT)-transcription factors can be dynamically degraded by an atypical ubiquitin E3 ligase complex Skp1-Pam-Fbxo45 (SPFFbxo45).
24992930 Fbxo45 is the substrate-receptor subunit of a functional E3 ligase for Par-4 that has a critical role in cancer cell survival.
24878430 Study found that the R108C mutation in FBXO45 is a rare variant with a modest effect on schizophrenia risk that may disrupt the structure and function of the FBXO45 protein
19581926 FBXO45 promotes the proteasome-dependent degradation of p73.
16012741 FBXO45 gene consisting of 3 exons, and the vicinity of the transcriptional start site had several estrogen receptor binding consensus sequences.

AA Sequence

MAAPAPGAGAASGGAGCSGGGAGAGAGSGSGAAGAGGRLPSRVLELVFSYLELSELRSCALVCKHWYRCL      1 - 70
HGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQS     71 - 140
TDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGE    141 - 210
VNGSFPQCNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYL    211 - 280
GKPLDG                                                                    281 - 286
//

Text Mined References (10)

PMID Year Title
25460509 2015 Atypical ubiquitin E3 ligase complex Skp1-Pam-Fbxo45 controls the core epithelial-to-mesenchymal transition-inducing transcription factors.
24992930 2014 Fbxo45-mediated degradation of the tumor-suppressor Par-4 regulates cancer cell survival.
24878430 2014 Novel rare variants in F-box protein 45 (FBXO45) in schizophrenia.
21269460 2011 Initial characterization of the human central proteome.
19581926 2009 The F-box protein FBXO45 promotes the proteasome-dependent degradation of p73.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16012741 2005 Characterization of estrogen-induced F-box protein FBXO45.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.