Property Summary

NCBI Gene PubMed Count 1
PubMed Score 8.65
PubTator Score 0.13

Knowledge Summary

Patent

No data available

AA Sequence

MSSTYCGNSSAKMSVNEVSAFSLTLEQKTGFAFVGILCIFLGLLIIRCFKILLDPYSSMPSSTWEDEVEE      1 - 70
FDKGTFEYALA                                                                71 - 81
//

Text Mined References (2)

PMID Year Title