Property Summary

NCBI Gene PubMed Count 1
PubMed Score 7.32
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSSTYCGNSSAKMSVNEVSAFSLTLEQKTGFAFVGILCIFLGLLIIRCFKILLDPYSSMPSSTWEDEVEE      1 - 70
FDKGTFEYALA                                                                71 - 81
//

Text Mined References (2)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.