Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.60
PubTator Score 2.83

Knowledge Summary

Patent (470)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Multiple Sclerosis 498

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 2.400 0.001

Gene RIF (1)

PMID Text
12471243 Better known as SgK069. Contains predicted active kinase domain, classified into the NKF1 metazoan-specific family of kinases. "Bsk146" is an obsolete term for it's paralog, SBK1.

AA Sequence

MPGKQSEEGPAEAGASEDSEEEGLGGLTLEELQQGQEAARALEDMMTLSAQTLVRAEVDELYEEVRPLGQ      1 - 70
GCYGRVLLVTHRQKGTPLALKQLPKPRTSLRGFLYEFCVGLSLGAHSAIVTAYGIGIESAHSYSFLTEPV     71 - 140
LHGDLMAFIQPKVGLPQPAVHRCAAQLASALEYIHARGLVYRDLKPENVLVCDPACRRFKLTDFGHTRPR    141 - 210
GTLLRLAGPPIPYTAPELCAPPPLPEGLPIQPALDAWALGVLLFCLLTGYFPWDRPLAEADPFYEDFLIW    211 - 280
QASGQPRDRPQPWFGLAAAADALLRGLLDPHPRRRSAVIAIREHLGRPWRQREGEAEAVGAVEEEAGQ      281 - 348
//

Text Mined References (3)

PMID Year Title
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12471243 2002 The protein kinase complement of the human genome.