Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.60
PubTator Score 2.83

Knowledge Summary

Patent (470)

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple Sclerosis 540 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 2.400 1.4e-03

Gene RIF (1)

AA Sequence

MPGKQSEEGPAEAGASEDSEEEGLGGLTLEELQQGQEAARALEDMMTLSAQTLVRAEVDELYEEVRPLGQ      1 - 70
GCYGRVLLVTHRQKGTPLALKQLPKPRTSLRGFLYEFCVGLSLGAHSAIVTAYGIGIESAHSYSFLTEPV     71 - 140
LHGDLMAFIQPKVGLPQPAVHRCAAQLASALEYIHARGLVYRDLKPENVLVCDPACRRFKLTDFGHTRPR    141 - 210
GTLLRLAGPPIPYTAPELCAPPPLPEGLPIQPALDAWALGVLLFCLLTGYFPWDRPLAEADPFYEDFLIW    211 - 280
QASGQPRDRPQPWFGLAAAADALLRGLLDPHPRRRSAVIAIREHLGRPWRQREGEAEAVGAVEEEAGQ      281 - 348
//

Text Mined References (3)

PMID Year Title