Property Summary

NCBI Gene PubMed Count 16
Grant Count 6
R01 Count 6
Funding $819,894.99
PubMed Score 62.28
PubTator Score 94.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.700 0.023
oligodendroglioma -1.500 0.043
glioblastoma -1.200 0.017
medulloblastoma -1.100 0.003
medulloblastoma, large-cell -1.600 0.000
adult high grade glioma -1.100 0.001
ovarian cancer 1.100 0.000

Synonym

Accession P0C1Z6
Symbols FB1
amida
INO80F

Gene

 GO Function (1)

Gene RIF (4)

PMID Text
23684607 TCF3/E2A is Conserved Specific Coregulators of the p21:PUMA Expression Ratio.
22723017 Characterization of the core promoters controlling the expression of PRPF31 and TFPT, a bi-directional gene-pair.
17395368 FB1 is an important binding partner and a functional regulator of U19/EAF2, EAF1, and/or ELL.
17041757 Although p53 is a main regulator of apoptosis in mammalian cells, the Tfpt induced apoptosis appears p53-independent.

AA Sequence

MELEQREGTMAAVGFEEFSAPPGSELALPPLFGGHILESELETEVEFVSGGLGGSGLRERDEEEEAARGR      1 - 70
RRRQRELNRRKYQALGRRCREIEQVNERVLNRLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQFTIVL     71 - 140
EDEGSQGTDAPTPGNAENEPPEKETLSPPRRTPAPPEPGSPAPGEGPSGRKRRRVPRDGRRAGNALTPEL    141 - 210
APVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTLASPASD                               211 - 253
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23684607 2013 A genetic screen identifies TCF3/E2A and TRIAP1 as pathway-specific regulators of the cellular response to p53 activation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22723017 2012 Expression of PRPF31 and TFPT: regulation in health and retinal disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...