Property Summary

NCBI Gene PubMed Count 16
PubMed Score 62.28
PubTator Score 94.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
medulloblastoma, large-cell 6234 2.35540379586957E-5
ovarian cancer 8492 1.74669742385593E-4
adult high grade glioma 2148 0.00115103146716041
medulloblastoma 1524 0.00346721810833749
glioblastoma 5572 0.0165176929931177
astrocytic glioma 2241 0.0227512303136855
oligodendroglioma 2849 0.0434959585763719
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Retinitis pigmentosa 156 3.069 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.700 0.023
oligodendroglioma -1.500 0.043
glioblastoma -1.200 0.017
medulloblastoma -1.100 0.003
medulloblastoma, large-cell -1.600 0.000
adult high grade glioma -1.100 0.001
ovarian cancer 1.100 0.000

Synonym

Accession P0C1Z6
Symbols FB1
amida
INO80F

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GO Function (1)

Gene RIF (4)

PMID Text
23684607 TCF3/E2A is Conserved Specific Coregulators of the p21:PUMA Expression Ratio.
22723017 Characterization of the core promoters controlling the expression of PRPF31 and TFPT, a bi-directional gene-pair.
17395368 FB1 is an important binding partner and a functional regulator of U19/EAF2, EAF1, and/or ELL.
17041757 Although p53 is a main regulator of apoptosis in mammalian cells, the Tfpt induced apoptosis appears p53-independent.

AA Sequence

MELEQREGTMAAVGFEEFSAPPGSELALPPLFGGHILESELETEVEFVSGGLGGSGLRERDEEEEAARGR      1 - 70
RRRQRELNRRKYQALGRRCREIEQVNERVLNRLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQFTIVL     71 - 140
EDEGSQGTDAPTPGNAENEPPEKETLSPPRRTPAPPEPGSPAPGEGPSGRKRRRVPRDGRRAGNALTPEL    141 - 210
APVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTLASPASD                               211 - 253
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23684607 2013 A genetic screen identifies TCF3/E2A and TRIAP1 as pathway-specific regulators of the cellular response to p53 activation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22723017 2012 Expression of PRPF31 and TFPT: regulation in health and retinal disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...