Property Summary

NCBI Gene PubMed Count 17
PubMed Score 63.15
PubTator Score 94.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 1.2e-03
astrocytic glioma -1.700 2.3e-02
glioblastoma -1.200 1.7e-02
group 4 medulloblastoma -1.100 7.8e-04
medulloblastoma, large-cell -1.600 2.4e-05
oligodendroglioma -1.500 4.3e-02
ovarian cancer 1.100 1.7e-04

 GO Function (1)

Gene RIF (4)

AA Sequence

MELEQREGTMAAVGFEEFSAPPGSELALPPLFGGHILESELETEVEFVSGGLGGSGLRERDEEEEAARGR      1 - 70
RRRQRELNRRKYQALGRRCREIEQVNERVLNRLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQFTIVL     71 - 140
EDEGSQGTDAPTPGNAENEPPEKETLSPPRRTPAPPEPGSPAPGEGPSGRKRRRVPRDGRRAGNALTPEL    141 - 210
APVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTLASPASD                               211 - 253
//

Text Mined References (26)

PMID Year Title