Property Summary

NCBI Gene PubMed Count 6
Grant Count 27
R01 Count 12
Funding $3,036,258.31
PubMed Score 13.32
PubTator Score 5.22

Knowledge Summary

Patent (159)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.000

AA Sequence

MDDKDIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPLSNVHELDTSS      1 - 70
EKDKESPDQILRTPVSHPLKCPETPAQPDSRSKLLPSDSPSTPKTMLSRLVISPTGKLPSRGPKHLKLTP     71 - 140
APLKDEMTSLALVNINPFTPESYKKLFLQSGGKRKIRGDLEEAGPEEGKGGLPAKRCVLRETNMASRYEK    141 - 210
EFLEVEKIGVGEFGTVYKCIKRLDGCVYAIKRSMKTFTELSNENSALHEVYAHAVLGHHPHVVRYYSSWA    211 - 280
EDDHMIIQNEYCNGGSLQAAISENTKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLDIKPSNIFICHK    281 - 350
MQSESSGVIEEVENEADWFLSANVMYKIGDLGHATSINKPKVEEGDSRFLANEILQEDYRHLPKADIFAL    351 - 420
GLTIAVAAGAESLPTNGAAWHHIRKGNFPDVPQELSESFSSLLKNMIQPDAEQRPSAAALARNTVLRPSL    421 - 490
GKTEELQQQLNLEKFKTATLERELREAQQAQSPQGYTHHGDTGVSGTHTGSRSTKRLVGGKSARSSSFTS    491 - 560
GEREPLH                                                                   561 - 567
//

Text Mined References (8)

PMID Year Title
23568457 2013 Genetic variants associated with disordered eating.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16341674 2005 Transcriptome analysis of human gastric cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
11181995 2001 The sequence of the human genome.
11029659 2000 Identification and characterization of human Wee1B, a new member of the Wee1 family of Cdk-inhibitory kinases.