Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Atypical teratoid rhabdoid tumor 7 4.381 2.2

Expression

Synonym

Accession P0C1H6 A6NP82
Symbols

Gene

AA Sequence

MAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSFTPYFPRVLKQ      1 - 70
VHQGLSLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMAVRLLLPGKMGKLAEAQGTNA     71 - 140
ALRTSLCAIWQQRK                                                            141 - 154
//

Text Mined References (5)

PMID Year Title
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.