Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Atypical teratoid rhabdoid tumor 6 4.324 2.2

Expression

AA Sequence

MAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSFTPYFPRVLKQ      1 - 70
VHQGLSLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMAVRLLLPGKMGKLAEAQGTNA     71 - 140
ALRTSLCAIWQQRK                                                            141 - 154
//

Text Mined References (5)

PMID Year Title