Property Summary

NCBI Gene PubMed Count 22
PubMed Score 9.72
PubTator Score 3.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.500 1.2e-02
hepatocellular carcinoma 1.300 2.3e-03
pancreatic cancer 2.600 5.0e-04
malignant mesothelioma 2.500 2.6e-08
cutaneous lupus erythematosus 1.700 9.2e-03
glioblastoma 1.700 2.8e-03
atypical teratoid / rhabdoid tumor 1.400 6.8e-03
intraductal papillary-mucinous carcinoma... 1.300 3.4e-02
intraductal papillary-mucinous neoplasm ... 2.000 4.6e-04
lung cancer 2.200 1.4e-02
colon cancer -2.300 3.7e-03
breast carcinoma 1.200 8.2e-03
lung adenocarcinoma 1.400 3.3e-16
pediatric high grade glioma 1.600 4.8e-04
sonic hedgehog group medulloblastoma 1.400 1.1e-02
pancreatic carcinoma 2.600 5.0e-04
inflammatory breast cancer 1.200 3.0e-03
Breast cancer 2.400 5.9e-13
non-small cell lung carcinoma 1.100 3.4e-20
ovarian cancer 1.600 6.6e-03
psoriasis 2.000 2.6e-05

 GO Process (1)

Gene RIF (5)

PMID Text
19571809 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (43)

PMID Year Title
25470042 2014 TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.
25281266 2014 Structural insights into recognition of acetylated histone ligands by the BRPF1 bromodomain.
24352239 2014 Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification.
24140421 2013 VprBP has intrinsic kinase activity targeting histone H2A and represses gene transcription.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22980979 2012 RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.
22713238 2012 A novel ubiquitin mark at the N-terminal tail of histone H2As targeted by RNF168 ubiquitin ligase.
22194607 2012 Macro histone H2A1.2 (macroH2A1) protein suppresses mitotic kinase VRK1 during interphase.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20618440 2010 Proteomic and biochemical analysis of 14-3-3-binding proteins during C2-ceramide-induced apoptosis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19571809 2009 Common variants on chromosome 6p22.1 are associated with schizophrenia.
19203579 2009 RNF168 binds and amplifies ubiquitin conjugates on damaged chromosomes to allow accumulation of repair proteins.
19203578 2009 The RIDDLE syndrome protein mediates a ubiquitin-dependent signaling cascade at sites of DNA damage.
18688256 2008 Molecular mimicry between IL-33 and KSHV for attachment to chromatin through the H2A-H2B acidic pocket.
18001825 2007 RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly.
18001824 2007 RNF8 ubiquitylates histones at DNA double-strand breaks and promotes assembly of repair proteins.
17980597 2007 Human USP3 is a chromatin modifier required for S phase progression and genome stability.
16702407 2006 DNA damage triggers nucleotide excision repair-dependent monoubiquitylation of histone H2A.
16457589 2006 Precise characterization of human histones in the H2A gene family by top down mass spectrometry.
16359901 2005 Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing.
16319397 2006 Characterization of histone H2A and H2B variants and their post-translational modifications by mass spectrometry.
15823041 2005 Deimination of histone H2A and H4 at arginine 3 in HL-60 granulocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15386022 2004 Role of histone H2A ubiquitination in Polycomb silencing.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15078818 2004 Nucleosomal histone kinase-1 phosphorylates H2A Thr 119 during mitosis in the early Drosophila embryo.
15010469 2004 Phosphorylation of histone H2A inhibits transcription on chromatin templates.
14657027 2003 Regulation of HIV-1 gene expression by histone acetylation and factor recruitment at the LTR promoter.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
11709551 2002 Global regulation of post-translational modifications on core histones.
11689053 2001 Enhancement of the p300 HAT activity by HIV-1 Tat on chromatin DNA.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
10384058 1999 The genomic organization of the histone clusters on human 6p21.3.
10064132 1999 The human H2A and H2B histone gene complement.
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.
9439656 1997 The human histone gene cluster at the D6S105 locus.
8179821 1994 The relative expression of human histone H2A genes is similar in different types of proliferating cells.
7410338 1980 Human spleen histone H2A. Isolation and four variant sequences.
1768865 1991 A novel divergently transcribed human histone H2A/H2B gene pair.