Property Summary

NCBI Gene PubMed Count 22
PubMed Score 9.72
PubTator Score 3.43

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0C0S8 P02261 Q2M1R2 Q76PA6 H2A.1
Symbols H2AG
H2A/p
H2AFP
H2A.1b
pH2A/f

Gene

PDB

5KGF   4QYL  

 GO Process (1)

Gene RIF (5)

PMID Text
19571809 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (43)

PMID Year Title
25470042 2014 TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.
25281266 2014 Structural insights into recognition of acetylated histone ligands by the BRPF1 bromodomain.
24352239 2014 Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification.
24140421 2013 VprBP has intrinsic kinase activity targeting histone H2A and represses gene transcription.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22980979 2012 RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.
22713238 2012 A novel ubiquitin mark at the N-terminal tail of histone H2As targeted by RNF168 ubiquitin ligase.
22194607 2012 Macro histone H2A1.2 (macroH2A1) protein suppresses mitotic kinase VRK1 during interphase.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...