Property Summary

NCBI Gene PubMed Count 23
PubMed Score 9.43
PubTator Score 3.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 6.8e-03
Breast cancer 1.600 2.5e-05
breast carcinoma 1.200 8.2e-03
colon cancer -2.300 3.7e-03
cutaneous lupus erythematosus 1.700 9.2e-03
gastric cancer 1.500 1.2e-02
glioblastoma 1.200 1.6e-03
hepatocellular carcinoma 1.300 2.3e-03
inflammatory breast cancer 1.200 3.0e-03
intraductal papillary-mucinous carcinoma... 1.300 3.4e-02
intraductal papillary-mucinous neoplasm ... 2.000 4.6e-04
lung adenocarcinoma 1.400 3.3e-16
lung cancer 2.200 1.4e-02
malignant mesothelioma 2.500 2.6e-08
non-small cell lung carcinoma 1.100 3.4e-20
ovarian cancer 1.600 6.6e-03
pancreatic cancer 2.600 5.0e-04
pancreatic carcinoma 2.600 5.0e-04
pediatric high grade glioma 1.600 4.8e-04
psoriasis 2.000 2.6e-05
sonic hedgehog group medulloblastoma 1.400 1.1e-02

Gene RIF (5)

AA Sequence

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (48)

PMID Year Title