Property Summary

NCBI Gene PubMed Count 84
PubMed Score 344.78
PubTator Score 181.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.416 1.1e-07
Breast cancer 4.900 2.2e-02
breast carcinoma 1.500 6.7e-06
dermatomyositis 1.400 3.9e-03
diabetes mellitus -1.100 2.0e-02
ductal carcinoma in situ 1.300 1.4e-03
Endometriosis 1.136 1.5e-02
group 3 medulloblastoma 1.200 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.100 3.3e-02
invasive ductal carcinoma 1.600 3.8e-04
lung cancer 2.100 3.6e-04
Multiple myeloma 1.503 8.2e-03
ovarian cancer -1.200 1.4e-02
psoriasis 1.500 1.4e-04
Waldenstrons macroglobulinemia 1.362 1.4e-02

Gene RIF (49)

AA Sequence

MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELA      1 - 70
GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV                 71 - 128
//

Text Mined References (86)

PMID Year Title