Property Summary

NCBI Gene PubMed Count 77
Grant Count 153
R01 Count 91
Funding $31,708,147.29
PubMed Score 304.45
PubTator Score 181.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.409 0.007
Multiple myeloma 1.503 0.008
psoriasis 1.500 0.000
adrenocortical carcinoma 1.416 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.033
lung cancer 2.100 0.000
breast carcinoma 1.500 0.000
diabetes mellitus -1.100 0.020
Breast cancer 4.900 0.022
group 3 medulloblastoma 1.200 0.012
Endometriosis 1.136 0.015
ductal carcinoma in situ 1.300 0.001
invasive ductal carcinoma 1.600 0.000
ovarian cancer 1.900 0.006
dermatomyositis 1.400 0.004

Synonym

Accession P0C0S5 B2RD56 P17317 Q6I9U0 H2A/z
Symbols H2AZ
H2A.z
H2A/z
H2A.Z-1

Gene

PDB

4CAY   4NFT   5B31   5B32   5B33   3WA9   1F66   5CHL   5FUG  

Gene RIF (43)

PMID Text
26974126 The 2.7-A-resolution crystal structure of the human YL1-H2A.Z-H2B complex shows that YL1 binding, similarly to ANP32E binding, triggers an extension of the H2A.Z alphaC helix.
26833946 Results suggest that the N-terminal tail of H2A.Z makes distinctively different contributions to epigenetic events.
26246156 the H2AFZ gene may confer a risk for schizophrenia and contribute to the impairment of executive function in Han Chinese patients with schizophrenia.
26142279 H2A.Z removal from chromatin is the primary function of INO80 and ANP32E in promoting homologous recombination.
26051178 The findings implicate H2A.Z.2 as a mediator of cell proliferation and drug sensitivity in malignant melanoma.
26034280 Dynamic modulation of H2A.Z exchange and removal by Anp32e reveals the importance of the nucleosome surface and nucleosome dynamics in processing the damaged chromatin template during DSB repair.
25392085 Results demonstrated male-selective association of the H2AFZ gene with schizophrenia, and that modification of the H2AFZ signaling pathway warrants further study in terms of the pathophysiology of schizophrenia
24613878 Anp32e may help to resolve the non-nucleosomal H2A.Z aggregates and also facilitate the removal of H2A.Z at the +1 nucleosomes, and the latter may help RNA polymerase II to pass the first nucleosomal barrier.
24397596 the predictive values regarding low expressions of H2AFZ and CASP8AP2 and high white blood cell count suggest that these features could help to identify more accurately patients at greater risk of relapse.
24311584 A mutational analysis revealed that the amino-acid difference at position 38 is at least partially responsible for the structural polymorphism in the L1 loop region of H2A.Z.1 and H2A.Z.2.
More...

AA Sequence

MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELA      1 - 70
GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV                 71 - 128
//

Text Mined References (79)

PMID Year Title
26974126 2016 Molecular basis and specificity of H2A.Z-H2B recognition and deposition by the histone chaperone YL1.
26833946 2016 Genetic complementation analysis showed distinct contributions of the N-terminal tail of H2A.Z to epigenetic regulations.
26246156 2015 Association of common variants in H2AFZ gene with schizophrenia and cognitive function in patients with schizophrenia.
26142279 2015 Removal of H2A.Z by INO80 promotes homologous recombination.
26051178 2015 Histone Variant H2A.Z.2 Mediates Proliferation and Drug Sensitivity of Malignant Melanoma.
26034280 2015 Histone chaperone Anp32e removes H2A.Z from DNA double-strand breaks and promotes nucleosome reorganization and DNA repair.
25731851 2015 Nucleosome adaptability conferred by sequence and structural variations in histone H2A-H2B dimers.
25392085 2015 Association study of H2AFZ with schizophrenia in a Japanese case-control sample.
25362550 2015 A comprehensive view of the epigenetic landscape part I: DNA methylation, passive and active DNA demethylation pathways and histone variants.
24613878 2014 Anp32e, a higher eukaryotic histone chaperone directs preferential recognition for H2A.Z.
More...