Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7391.80
PubTator Score 35.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

 GO Component (1)

Gene RIF (13)

AA Sequence

MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRS      1 - 70
FRNGVGTGMKKTSFQRAKS                                                        71 - 89
//

Text Mined References (20)

PMID Year Title