Property Summary

NCBI Gene PubMed Count 160
Grant Count 77
R01 Count 49
Funding $9,083,538.95
PubMed Score 1088.30
PubTator Score 603.59

Knowledge Summary

Patent

No data available

Expression

Gene

C4B

PDB

4XAM   1HZF   4FXG   4FXK   5JPM   5JPN   5JTW  

 OMIM Term (1)

Gene RIF (119)

PMID Text
26814963 Schizophrenia risk from complex variation of complement component 4
26800705 C4A and C4B gene copy numbers are stronger risk factors for juvenile-onset than for adult-onset systemic lupus erythematosus
26678451 Data indicate Ig-like transcript 4 (ILT4) as a cellular receptor for complement split products (CSPs) complement component 4d (C4d).
26517116 The interaction between C4BP and Leptospira interrogans LcpA, LigA and LigB is sensitive to ionic strength and inhibited by heparin.
26305533 Carrying no copies of C4B significantly increases the risk of cCSC, whereas carrying three C4B copies is protective.
26151608 Isolated C4d deposition and isolated interstitial inflammation appear to be benign lesions, but C4d deposition in association with interstitial inflammation in the biopsy is strongly associated with the development of chronic graft dysfunction.
26071493 Suggest a prominent prognostic value of C4d staining as a rejection marker in ABO compatible kidney transplantation.
26031580 C4d-negative acute antibody-mediated graft rejection resembles C4d-positive aAMR in terms of clinical and pathological features. C4d positivity has no influence on short-term outcome.
25894167 Late antibody/C4d-mediated rejection can emerge soon after the modification of immunosuppressive drug dosages and may be responsible for graft dysfunction or loss.
25799154 Elevated levels of the complement activation product C4d in bronchial fluids is associated with lung cancer.
More...

AA Sequence

MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRNPSRNNVPCSP      1 - 70
KVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDSLSRTTNIQGINLLFSSRRGH     71 - 140
LFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYMPSSIFQDDFVIPDISEP    141 - 210
GTWKISARFSDGLESNSSTQFEVKKYVLPNFEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVA    211 - 280
YVRFGLLDEDGKKTFFRGLESQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGG    281 - 350
EMEEAELTSWYFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQD    351 - 420
IQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDSRPPRVGDTLN    421 - 490
LNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPSFYFVAFYYHGDHPVANSLRV    491 - 560
DVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVALGALDTALYAAGSKSHKPLNMGKVFEAMNS    561 - 630
YDLGCGPGGGDSALQVFQAAGLAFSDGDQWTLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAK    631 - 700
RCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDED    701 - 770
DIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLP    771 - 840
MSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVS    841 - 910
LKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRV    911 - 980
TASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQ    981 - 1050
KGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDP   1051 - 1120
CPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGA   1121 - 1190
HAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPAL   1191 - 1260
WIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVT   1261 - 1330
LSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIE   1331 - 1400
VTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEGRRNRRRREAPKVVEEQESRVHYTV   1401 - 1470
CIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEA   1471 - 1540
VQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDED   1541 - 1610
GYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPG   1611 - 1680
KEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV         1681 - 1744
//

Text Mined References (177)

PMID Year Title
26814963 2016 Schizophrenia risk from complex variation of complement component 4.
26800705 2016 Low C4, C4A and C4B gene copy numbers are stronger risk factors for juvenile-onset than for adult-onset systemic lupus erythematosus.
26678451 2016 Ig-like transcript 4 as a cellular receptor for soluble complement fragment C4d.
26517116 2015 Fine Mapping of the Interaction between C4b-Binding Protein and Outer Membrane Proteins LigA and LigB of Pathogenic Leptospira interrogans.
26305533 2015 Genomic Copy Number Variations of the Complement Component C4B Gene Are Associated With Chronic Central Serous Chorioretinopathy.
26151608 2015 Incidence and Outcome of C4d Staining With Tubulointerstitial Inflammation in Blood Group-incompatible Kidney Transplantation.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26071493 2015 Capillary C4d and Kidney Allograft Outcome in Relation to Morphologic Lesions Suggestive of Antibody-Mediated Rejection.
26031580 2015 The impact of C4d-negative acute antibody-mediated rejection on short-term prognosis among kidney transplant recipients.
25894167 2015 Evaluation of late antibody-mediated rejection (C4d-mediated rejection): a single-center experience.
More...