Property Summary

NCBI Gene PubMed Count 9
PubMed Score 60.34
PubTator Score 10.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MSAPGSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGTAESPYSHLGGIDYKTTTILLDGQRVKLKLWDT      1 - 70
SGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPGVPKILVGNRLHLAFKRQVPREQ     71 - 140
AQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRLNWLGRPSKVLSLQDLCCRTIVSCTPVHLVD    141 - 210
KLPLPIALRSHLKSFSMAKGLNARMMRGLSYSLTTSSTHKRSSLCKVKIVCPPQSPPKNCTRNSCKIS      211 - 278
//

Text Mined References (9)

PMID Year Title