Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.46
PubTator Score 0.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -1.400 2.2e-07
ductal carcinoma in situ -1.500 3.9e-04
glioblastoma -1.300 4.2e-03
invasive ductal carcinoma -2.000 2.1e-03
medulloblastoma, large-cell -1.900 9.8e-03
non diabetic and post-ischemic heart fai... 1.400 1.4e-02
osteosarcoma -1.927 4.3e-03
ovarian cancer -1.800 1.2e-11
pancreatic ductal adenocarcinoma liver m... -1.792 4.4e-03
ulcerative colitis -1.100 8.9e-04

Gene RIF (1)

AA Sequence

MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGE      1 - 70
VCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAE     71 - 140
VKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTF    141 - 210
EVQFNLNDVLASSEELFLKVHKKATSRL                                              211 - 238
//

Text Mined References (7)

PMID Year Title