Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.46
PubTator Score 0.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.927 0.004
non diabetic and post-ischemic heart fai... 1.400 0.014
glioblastoma -1.300 0.004
medulloblastoma, large-cell -1.900 0.010
pancreatic ductal adenocarcinoma liver m... -1.792 0.004
Breast cancer -1.400 0.000
ductal carcinoma in situ -1.500 0.000
invasive ductal carcinoma -2.000 0.002
ulcerative colitis -1.100 0.001
ovarian cancer -1.800 0.000

Synonym

Accession P0C024 B4DLE5 H3BUB8
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
19844255 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGE      1 - 70
VCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAE     71 - 140
VKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTF    141 - 210
EVQFNLNDVLASSEELFLKVHKKATSRL                                              211 - 238
//

Text Mined References (7)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11415433 2001 The mouse Nudt7 gene encodes a peroxisomal nudix hydrolase specific for coenzyme A and its derivatives.