Property Summary

NCBI Gene PubMed Count 32
PubMed Score 43.98
PubTator Score 10.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.460 2.2e-02
adult high grade glioma -1.500 9.0e-05
atypical teratoid / rhabdoid tumor -4.000 7.6e-12
breast carcinoma -1.300 9.4e-04
cutaneous lupus erythematosus -1.200 2.6e-02
ductal carcinoma in situ -1.800 3.8e-04
ependymoma -1.900 5.8e-08
fibroadenoma -1.200 4.5e-02
glioblastoma -2.300 7.1e-06
group 3 medulloblastoma -3.900 8.5e-08
invasive ductal carcinoma -2.000 1.3e-03
lung carcinoma 1.600 6.4e-28
medulloblastoma, large-cell -4.200 6.6e-08
non-small cell lung cancer 1.380 1.1e-15
primitive neuroectodermal tumor -2.900 4.3e-04
psoriasis -1.100 1.1e-44
subependymal giant cell astrocytoma -3.276 8.2e-03

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRV      1 - 70
KKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKK     71 - 140
DGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL    141 - 210
AAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEA    211 - 280
SFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDG    281 - 350
GAAAQSLYIANHAY                                                            351 - 364
//

Text Mined References (38)

PMID Year Title