Property Summary

NCBI Gene PubMed Count 30
PubMed Score 43.09
PubTator Score 10.15

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P09972 B2R5R3 Q3SYL3 Q6FH94 Q6P0L5
Symbols ALDC

Gene

PDB

1XFB  

Gene RIF (9)

PMID Text
24993527 ALDOC, Aldolase A (ALDOA) and Aldolase B (ALDOB) activate Wnt signaling.
24525694 residues 85-102 harbor the epitope-containing region recognized by MAb 9F
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of fructose-bisphosphate aldolase C (ALDOC) expression by HIV-1 Vpr in Vpr transduced macrophages
20381070 This protein has been found differentially expressed in the anterior cingulate cortex in men patients with schizophrenia.
19686046 Results identified fructose bisphospate aldolase C that showed elevated levels of protein carbonyls in inferior parietal lobule (IPL) from subjects with early stage-Alzheimer's disease.
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
15589842 Diverse ALDOC promoter regions are required to direct specific LacZ expression in the hippocampus and Purkinje cells if transgenic mice.

AA Sequence

MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRV      1 - 70
KKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKK     71 - 140
DGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL    141 - 210
AAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEA    211 - 280
SFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDG    281 - 350
GAAAQSLYIANHAY                                                            351 - 364
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24993527 2014 Aldolase positively regulates of the canonical Wnt signaling pathway.
24525694 A novel anti-aldolase C antibody specifically interacts with residues 85-102 of the protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
More...