Property Summary

NCBI Gene PubMed Count 73
Grant Count 41
R01 Count 28
Funding $6,571,143.96
PubMed Score 115.03
PubTator Score 246.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.401 0.002
malignant mesothelioma -1.600 0.000
osteosarcoma -1.772 0.000
astrocytoma 1.300 0.008
tuberculosis 1.600 0.000
non-small cell lung cancer -1.266 0.000
lung carcinoma -1.400 0.000
acute myeloid leukemia -1.400 0.027
ovarian cancer -2.900 0.000

Synonym

Gene

PANTHER Protein Class (3)

PDB

1GW6   1H19   1HS6   1SQM   2R59   2VJ8   3B7R   3B7S   3B7T   3B7U   3CHO   3CHP   3CHQ   3CHR   3CHS   3FH5   3FH7   3FH8   3FHE   3FTS   3FTU   3FTV   3FTW   3FTX   3FTY   3FTZ   3FU0   3FU3   3FU5   3FU6   3FUD   3FUE   3FUF   3FUH   3FUI   3FUJ   3FUK   3FUL   3FUM   3FUN   3U9W   4DPR   4L2L   4MKT   4MS6   4R7L   4RSY   4RVB   5AEN   5BPP  

Gene RIF (36)

PMID Text
25799317 LTA4H promoter region SNP was associated with susceptibility to bacteriologically confirmed bacterial meningitis but did not influence clinical presentation, disease severity or survival following dexamethasone treatment.
25721704 Report no association between LTA4H SNPs and atherosclerotic plaque phenotypes.
24573245 The best proteinogenic amino acid recognized by LTA4H is arginine.
23828562 The results of our study failed to confirm whether the selected variants in LTA4H gene within the LT metabolism pathway contribute to platelet reactivity in a diabetic population treated with ASA.
23573270 The LTA4H A-9188>G polymorphism has a strong association with severe asthma in children.
23504711 Data indicate that 13S,14S-epoxy-docosahexaenoic acid (DHA) inhibits leukotriene B4 (LTB4) biosynthesis by leukotriene A4 hydrolase (LTA4H).
23153620 We identified a novel leukotriene haplotype that appears to be protective toward subclinical atherosclerosis. This association is modified by dietary intake of polyunsaturated fatty acids
23079278 genetic association studies in population of Han Chinese in Eastern China: Using a recessive genetic model, an SNP in LTA4H (rs6538697) is associated with increased risk of ischemic stroke.
22848428 Structural origins for the loss of catalytic activities of bifunctional human LTA4H revealed through molecular dynamics simulations.
22206291 It was found modest association with LTA4H rs1978331C (intron 11) with increased FEV1 (p = 0.029) and with increased FEV1/FVC ratio (p = 0.020).
More...

AA Sequence

MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQ      1 - 70
EVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIH     71 - 140
CRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGAL    141 - 210
ESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVT    211 - 280
PTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGEL    281 - 350
QNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI    351 - 420
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNAT    421 - 490
DLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMAT    491 - 560
EQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVTAMLVGKDLKVD                       561 - 611
//

Text Mined References (85)

PMID Year Title
26208604 2015 A Potential Role for Acrolein in Neutrophil-Mediated Chronic Inflammation.
26151090 2015 A Randomized, Placebo-controlled Trial of Roflumilast. Effect on Proline-Glycine-Proline and Neutrophilic Inflammation in Chronic Obstructive Pulmonary Disease.
25799317 2015 LTA4H genotype is associated with susceptibility to bacterial meningitis but is not a critical determinant of outcome.
25721704 2015 Variants in ALOX5, ALOX5AP and LTA4H are not associated with atherosclerotic plaque phenotypes: the Athero-Express Genomics Study.
25625859 2015 PENG: a neural gas-based approach for pharmacophore elucidation. method design, validation, and virtual screening for novel ligands of LTA4H.
25257262 2014 Relationship between human LTA4H polymorphisms and extra-pulmonary tuberculosis in an ethnic Han Chinese population in Eastern China.
25072959 2014 The arachidonic acid-LTB4-BLT2 pathway enhances human B-CLL aggressiveness.
24874071 2014 An aberrant leukotriene A4 hydrolase-proline-glycine-proline pathway in the pathogenesis of chronic obstructive pulmonary disease.
24591641 2014 Binding of Pro-Gly-Pro at the active site of leukotriene A4 hydrolase/aminopeptidase and development of an epoxide hydrolase selective inhibitor.
24573245 2014 A remarkable activity of human leukotriene A4 hydrolase (LTA4H) toward unnatural amino acids.
More...