Property Summary

NCBI Gene PubMed Count 185
Grant Count 305
R01 Count 128
Funding $53,719,333.68
PubMed Score 1118.74
PubTator Score 782.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.900 0.001
pancreatic ductal adenocarcinoma liver m... -1.198 0.006
lung carcinoma 1.400 0.000

Synonym

Accession P09958 Q14336 Q6LBS3 Q9UCZ5
Symbols FUR
PACE
SPC1
PCSK3

Gene

PANTHER Protein Class (3)

PDB

4OMC   4OMD   4RYD   4Z2A  

Gene RIF (142)

PMID Text
26569287 The authors show that Human papillomavirus type 16 L2 is cleaved during virion morphogenesis in differentiated tissue and that tissue-derived native virus initiates infection independent of cellular furin.
26488448 Data show that both furin and brain type natriuretic peptide (BNP) were more sensitive than corin in predicting cardiovascular complications in type 2 diabetes mellitus (T2DM) patients.
26346780 the plasma level of FURIN does not predict the severity of infectious disease, it may be of use in the diagnostics of autoimmune diseases.
26283733 PAR1 inhibits the cleavage of HIV-1 gp160 to gp41 by furin
26283733 PAR1 inhibits the cleavage of HIV-1 gp160 to gp41 by furin
26283728 These data highlight a positive-feedback loop whereby Notch1-dependent furin expression can induce Notch1 signaling by increasing Notch1 processing and by potentiating the activity of ADAM10 and Membrane Type 1 Matrix Metalloproteinase.
26137475 we could not confirm an effect of the SNP on FURIN expression in vitro and no correlations could be found in vivo with FURIN expression or outcome.
26065233 High levels of furin, TNF-alpha and TGF-beta2 may be the reason of proceeding decidualization, placentation, and prevention from abortion, in spite of terminating the fetal life.
25933376 Data suggest that the full Crimean-Congo hemorrhagic fever virus can be reproduced by reverse genetics; in this system, furin cleavage of the nonstructural glycoprotein reveals mature GP38.
25813623 a phenotypic analysis demonstrated that a novel cis-eQTL SNP rs4702 for FURIN is strongly associated with both diastolic (p = 0.012) and systolic (p = 0.035) BP levels, as well as peripheral vascular resistance (p = 0.003).
More...

AA Sequence

MELRPWLLWVVAATGTLVLLAADAQGQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHR      1 - 70
GVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQ     71 - 140
GYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGV    141 - 210
CGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQ    211 - 280
GRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQ    281 - 350
IVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV    351 - 420
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQAR    421 - 490
LTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNY    491 - 560
GTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHYSTE    561 - 630
NDVETIRASVCAPCHASCATCQGPALTDCLSCPSHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEVEA    631 - 700
GQRLRAGLLPSHLPEVVAGLSCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEE    701 - 770
CPSDSEEDEGRGERTAFIKDQSAL                                                  771 - 794
//

Text Mined References (187)

PMID Year Title
26569287 2015 Cleavage of the HPV16 Minor Capsid Protein L2 during Virion Morphogenesis Ablates the Requirement for Cellular Furin during De Novo Infection.
26488448 2015 Diagnostic utility of BNP, corin and furin as biomarkers for cardiovascular complications in type 2 diabetes mellitus patients.
26346780 2015 The Plasma Level of Proprotein Convertase FURIN in Patients with Suspected Infection in the Emergency Room: A Prospective Cohort Study.
26283728 2015 Notch1 Autoactivation via Transcriptional Regulation of Furin, Which Sustains Notch1 Signaling by Processing Notch1-Activating Proteases ADAM10 and Membrane Type 1 Matrix Metalloproteinase.
26137475 2015 Single Nucleotide Polymorphism (rs4932178) in the P1 Promoter of FURIN Is Not Prognostic to Colon Cancer.
26065233 2015 Distribution of furin, TNF-?, and TGF-?2 in the endometrium of missed abortion and voluntary first trimester termination cases.
25933376 2015 Recovery of Recombinant Crimean Congo Hemorrhagic Fever Virus Reveals a Function for Non-structural Glycoproteins Cleavage by Furin.
25813623 2015 A genome-wide expression quantitative trait loci analysis of proprotein convertase subtilisin/kexin enzymes identifies a novel regulatory gene variant for FURIN expression and blood pressure.
25552509 [Membrane type 1 matrix metalloproteinase (MT1-MMP) and the regulators of its activity as invasive factors in squamous cell cervical carcinomas].
25543063 2015 K153R polymorphism in myostatin gene increases the rate of promyostatin activation by furin.
More...