Property Summary

NCBI Gene PubMed Count 208
Grant Count 145
R01 Count 56
Funding $20,005,137.66
PubMed Score 1364.68
PubTator Score 994.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (51)

Disease Z-score Confidence
Parkinson's disease 364 5.072 2.5
Leber congenital amaurosis 72 4.925 2.5
Cancer 2,346 4.69 2.3
Neuropathy 210 4.275 2.1
Hirschsprung's disease 42 3.93 2.0
Histiocytosis 12 3.481 1.7
Endometriosis 535 3.391 1.7
Granular cell tumor 8 3.285 1.6
Alzheimer's disease 644 3.099 1.5
Skin disease 65 3.017 1.5
Hypertrophic pyloric stenosis 4 3.016 1.5
Atopic dermatitis 944
Diaphragmatic Hernia 40
Esophageal Neoplasms 67
Liver carcinoma 217
NEURODEGENERATION WITH OPTIC ATROPHY, CH... 1 
Neurodegenerative disease 383 4.0
PARKINSON DISEASE 5, AUTOSOMAL DOMINANT 1
PARKINSON DISEASE, LATE-ONSET 18
Peripheral Neuropathy 303
Pick disease 1,893
X-linked recessive Emery-Dreifuss muscul... 18 
acute myeloid leukemia 780
adult high grade glioma 2,148
aldosterone-producing adenoma 664
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
colon cancer 1,475
cystic fibrosis 1,665
diabetes mellitus 1,663
gallbladder neoplasm 9
glioblastoma multiforme 347
group 3 medulloblastoma 2,254
head and neck cancer 270
head and neck cancer and chronic obstruc... 237 
inflammatory breast cancer 404
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
non-small cell lung carcinoma 413
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
psoriasis 6,685

Expression

Synonym

Accession P09936 Q4W5K6 Q71UM0 UCH-L1
Symbols NDGOA
PARK5
PGP95
PGP9.5
Uch-L1
HEL-117
PGP 9.5
HEL-S-53

Gene

PANTHER Protein Class (3)

PDB

3IFW   3KVF   3KW5   2ETL   2LEN   3IRT   4DM9   4JKJ  

Gene RIF (190)

PMID Text
26823707 UCH-L1 is a promising prognostic biomarker for GCAs and might play an important role in the carcinogenesis of gastric cancer.
26810533 Folloing aneurysmal subarachnoid hemorrhage, eleevated UCH-L1 levels during the five-day follow-up were associated with unfavorable neurological outcome.
26722437 UCH-L1 plays a crucial role in modulating the degradation of EGFR and promoting malignant properties in multi-drug resistant breast cancer
26702068 The neuronal marker UCH-L1 is induced in, and specifically augments the oncogene-induced transformation of, germinal center B cells.
26550574 The promoter methylation degree of FLNC, THBS1, UCHL1, and DLEC1 in serum could tell the existence of GC and only UCHL1 in the serum was also associated with poor prognosis of GC.
26547005 UCH-L1 is significantly associated with outcome, but it does not add predictive power to commonly used prognostic variables in a population of patients with TBI of varying severities.
26513019 High UCHL1 expression is associated with multiple myeloma.
26264933 UCHL1 expression is highly upregulated upon hepatic stellate cell (HSC) activation and is involved in the regulation of HSC proliferation
26232084 Serum UCH-l1 levels serve as a novel biomarker for neuronal damage from white matter lesions.
26040028 These findings suggest that UCHL1 expression is conserved in the mammalian testis, and could be used as a specific marker for gonocytes/spermatogonia for developing male germ-cell based conservation techniques.
More...

AA Sequence

MQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAPACALLLLFPLTAQHENFRKKQIEEL      1 - 70
KGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQ     71 - 140
AAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQG    141 - 210
EVRFSAVALCKAA                                                             211 - 223
//

Text Mined References (212)

PMID Year Title
26823707 2015 UCH-LI acts as a novel prognostic biomarker in gastric cardiac adenocarcinoma.
26810533 2016 Increased plasma UCH-L1 after aneurysmal subarachnoid hemorrhage is associated with unfavorable neurological outcome.
26722437 2015 UCH-L1 involved in regulating the degradation of EGFR and promoting malignant properties in drug-resistant breast cancer.
26702068 2016 UCH-L1 is induced in germinal center B cells and identifies patients with aggressive germinal center diffuse large B-cell lymphoma.
26550574 2015 The diagnosis value of promoter methylation of UCHL1 in the serum for progression of gastric cancer.
26547005 2016 Glial Fibrillary Acidic Protein and Ubiquitin C-Terminal Hydrolase-L1 as Outcome Predictors in Traumatic Brain Injury.
26513019 2015 UCHL1 is a biomarker of aggressive multiple myeloma required for disease progression.
26264933 2015 Ubiquitin C-terminal hydrolase 1: A novel functional marker for liver myofibroblasts and a therapeutic target in chronic liver disease.
26232084 2015 Changes of ubiquitin C-terminal hydrolase-L1 levels in serum and urine of patients with white matter lesions.
26040028 2015 Conserved expression of ubiquitin carboxyl-terminal esterase L1 (UCHL1) in mammalian testes.
More...