Property Summary

Ligand Count 5
NCBI Gene PubMed Count 225
PubMed Score 1414.17
PubTator Score 994.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (30)

Disease log2 FC p
acute myeloid leukemia -1.200 6.3e-03
adult high grade glioma -1.400 3.4e-04
aldosterone-producing adenoma -1.463 3.2e-02
astrocytic glioma -1.900 2.3e-03
Astrocytoma, Pilocytic -1.400 8.4e-08
Atopic dermatitis -1.100 8.7e-05
atypical teratoid / rhabdoid tumor -1.900 9.0e-04
Breast cancer 1.300 1.6e-04
colon cancer -2.100 2.3e-02
cystic fibrosis 3.097 1.3e-07
diabetes mellitus -1.100 2.0e-02
ependymoma -1.700 2.9e-02
glioblastoma -1.300 4.2e-04
group 3 medulloblastoma -2.200 8.0e-04
head and neck cancer -2.800 1.5e-02
head and neck cancer and chronic obstruc... -1.600 3.1e-02
intraductal papillary-mucinous adenoma (... -2.200 2.6e-07
intraductal papillary-mucinous carcinoma... -1.900 6.2e-06
intraductal papillary-mucinous neoplasm ... -1.900 1.1e-04
lung adenocarcinoma 1.300 6.8e-07
lung cancer 6.400 2.5e-08
lung carcinoma 4.400 3.4e-56
medulloblastoma, large-cell -1.500 4.8e-03
non-small cell lung cancer 3.234 1.2e-15
oligodendroglioma -1.900 2.1e-02
osteosarcoma 2.739 1.1e-02
ovarian cancer 1.200 3.4e-03
Pick disease -2.000 2.5e-03
psoriasis -1.200 2.7e-03
X-linked recessive Emery-Dreifuss muscul... 1.042 2.3e-02

 GWAS Trait (1)

Gene RIF (207)

AA Sequence

MQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAPACALLLLFPLTAQHENFRKKQIEEL      1 - 70
KGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQ     71 - 140
AAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQG    141 - 210
EVRFSAVALCKAA                                                             211 - 223
//

Text Mined References (229)

PMID Year Title