Property Summary

NCBI Gene PubMed Count 208
PubMed Score 1364.68
PubTator Score 994.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 3.44253227675439E-56
glioblastoma multiforme 347 4.90614963130542E-17
non-small cell lung cancer 2798 1.22898603034919E-15
posterior fossa group A ependymoma 1511 1.51953809145401E-9
lung cancer 4473 2.50022118688847E-8
pilocytic astrocytoma 3086 9.25517965526472E-8
cystic fibrosis 1670 1.28107187569639E-7
intraductal papillary-mucinous adenoma (IPMA) 2956 2.57619628121708E-7
lung adenocarcinoma 2714 6.84728003073321E-7
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.18271915042472E-6
Atopic dermatitis 944 8.65902361621673E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.07461764073724E-4
adult high grade glioma 2148 3.37941391155079E-4
group 3 medulloblastoma 2254 7.99753045248497E-4
atypical teratoid / rhabdoid tumor 4369 9.04932297755605E-4
astrocytic glioma 2241 0.0022569256752187
Pick disease 1893 0.00246627693961125
psoriasis 6685 0.00265776766187962
ovarian cancer 8492 0.0034345141800359
medulloblastoma, large-cell 6234 0.00482283299200308
acute myeloid leukemia 785 0.00626340647412559
osteosarcoma 7933 0.0105745932686442
head and neck cancer 270 0.0153530529984921
diabetes mellitus 1663 0.0203709478762432
oligodendroglioma 2849 0.0210287960260604
X-linked recessive Emery-Dreifuss muscular dystrophy 18 0.0228970982664283
colon cancer 1475 0.0229136296489368
head and neck cancer and chronic obstructive pulmonary disease 237 0.0308392089488012
aldosterone-producing adenoma 664 0.0318567873186623
inflammatory breast cancer 404 0.0470221637815811
Disease Target Count Z-score Confidence
Parkinson's disease 364 5.072 2.5
Neurodegenerative disease 383 0.0 4.0
Disease Target Count
Parkinson disease 5 1

Expression

Synonym

Accession P09936 Q4W5K6 Q71UM0 UCH-L1
Symbols NDGOA
PARK5
PGP95
PGP9.5
Uch-L1
HEL-117
PGP 9.5
HEL-S-53

Gene

PANTHER Protein Class (3)

PDB

3IFW   3KVF   3KW5   2ETL   2LEN   3IRT   4DM9   4JKJ  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (190)

PMID Text
26823707 UCH-L1 is a promising prognostic biomarker for GCAs and might play an important role in the carcinogenesis of gastric cancer.
26810533 Folloing aneurysmal subarachnoid hemorrhage, eleevated UCH-L1 levels during the five-day follow-up were associated with unfavorable neurological outcome.
26722437 UCH-L1 plays a crucial role in modulating the degradation of EGFR and promoting malignant properties in multi-drug resistant breast cancer
26702068 The neuronal marker UCH-L1 is induced in, and specifically augments the oncogene-induced transformation of, germinal center B cells.
26550574 The promoter methylation degree of FLNC, THBS1, UCHL1, and DLEC1 in serum could tell the existence of GC and only UCHL1 in the serum was also associated with poor prognosis of GC.
26547005 UCH-L1 is significantly associated with outcome, but it does not add predictive power to commonly used prognostic variables in a population of patients with TBI of varying severities.
26513019 High UCHL1 expression is associated with multiple myeloma.
26264933 UCHL1 expression is highly upregulated upon hepatic stellate cell (HSC) activation and is involved in the regulation of HSC proliferation
26232084 Serum UCH-l1 levels serve as a novel biomarker for neuronal damage from white matter lesions.
26040028 These findings suggest that UCHL1 expression is conserved in the mammalian testis, and could be used as a specific marker for gonocytes/spermatogonia for developing male germ-cell based conservation techniques.
More...

AA Sequence

MQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAPACALLLLFPLTAQHENFRKKQIEEL      1 - 70
KGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQ     71 - 140
AAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQG    141 - 210
EVRFSAVALCKAA                                                             211 - 223
//

Text Mined References (212)

PMID Year Title
26823707 2015 UCH-LI acts as a novel prognostic biomarker in gastric cardiac adenocarcinoma.
26810533 2016 Increased plasma UCH-L1 after aneurysmal subarachnoid hemorrhage is associated with unfavorable neurological outcome.
26722437 2015 UCH-L1 involved in regulating the degradation of EGFR and promoting malignant properties in drug-resistant breast cancer.
26702068 2016 UCH-L1 is induced in germinal center B cells and identifies patients with aggressive germinal center diffuse large B-cell lymphoma.
26550574 2015 The diagnosis value of promoter methylation of UCHL1 in the serum for progression of gastric cancer.
26547005 2016 Glial Fibrillary Acidic Protein and Ubiquitin C-Terminal Hydrolase-L1 as Outcome Predictors in Traumatic Brain Injury.
26513019 2015 UCHL1 is a biomarker of aggressive multiple myeloma required for disease progression.
26264933 2015 Ubiquitin C-terminal hydrolase 1: A novel functional marker for liver myofibroblasts and a therapeutic target in chronic liver disease.
26232084 2015 Changes of ubiquitin C-terminal hydrolase-L1 levels in serum and urine of patients with white matter lesions.
26040028 2015 Conserved expression of ubiquitin carboxyl-terminal esterase L1 (UCHL1) in mammalian testes.
More...