Property Summary

NCBI Gene PubMed Count 43
PubMed Score 194.55
PubTator Score 550.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease -1.119 7.1e-03
adult high grade glioma -1.100 1.5e-03
ulcerative colitis -1.200 5.7e-06

Gene RIF (20)

AA Sequence

MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTA      1 - 70
TRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQC     71 - 140
NTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLI    141 - 210
SNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQS    211 - 280
VTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEA    281 - 350
VMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF    351 - 420
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPY    421 - 490
TACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP                                    491 - 528
//

Text Mined References (47)

PMID Year Title