Property Summary

NCBI Gene PubMed Count 41
PubMed Score 191.75
PubTator Score 550.53

Knowledge Summary

Patent

No data available

Synonym

Accession P09923 B2R7Y4 Q53S80 Q9UBV5 Q9UCL2 IAP
Symbols IAP

Gene

PANTHER Protein Class (2)

Gene RIF (18)

PMID Text
27083970 Review of the role of intestinal alkaline phosphatase in inflammatory diseases. Loss of IAP expression or function is associated with increased intestinal inflammation, dysbiosis, bacterial translocation and subsequently systemic inflammation.
26844282 A High Level of Intestinal Alkaline Phosphatase Is Protective Against Type 2 Diabetes Mellitus Irrespective of Obesity
26299896 The expression of ALPi and MUC5AC in cocultures of Caco-2 and HT29 cells developed for permeability studies is reported.
25037223 Data indicate that histone deacetylase inhibitors (HDACi) induce intestinal alkaline phosphatase (ALPi) in a subset of colon cancer cell lines in a Kruppel-like factor 5 (KLF5)-dependent manner.
22783049 Report lowered intestinal alkaline phosphatase in the colonic mucosa of children with inflammatory bowel disease.
22262031 we are the first to demonstrate the alteration of protein expression of iAP in the duodenal mucosa of children with newly diagnosed coeliac disease
20489044 Mechanism of IAP action appears to be through dephosphorylation of specific bacterial components, including LPS, CpG DNA, and flagellin, and not on live bacteria. IAP likely targets these bacterially derived molecules as gut mucosal defense factor.
19407215 Suggest role for lysophosphatidylcholine in brush-border intestinal alkaline phosphatase release and restoration.
18307834 Cathepsin C propeptide interacts with intestinal alkaline phosphatase (IAP) and heat shock cognate protein 70. The propeptide of cathepsin C may stimulate the sorting to the lysosome contributing to the degradation of IAP in Caco-2 cells.
18292227 has the ability to detoxify lipopolysaccharide and prevent bacterial invasion across the gut mucosal barrier. IAP expression and function are lost with starvation and maintained by enteral feeding
More...

AA Sequence

MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTA      1 - 70
TRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQC     71 - 140
NTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLI    141 - 210
SNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQS    211 - 280
VTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEA    281 - 350
VMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF    351 - 420
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPY    421 - 490
TACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP                                    491 - 528
//

Text Mined References (45)

PMID Year Title
27083970 2016 Intestinal alkaline phosphatase: a summary of its role in clinical disease.
26844282 2015 A High Level of Intestinal Alkaline Phosphatase Is Protective Against Type 2 Diabetes Mellitus Irrespective of Obesity.
26299896 2015 Optimization of Caco-2 and HT29 co-culture in vitro cell models for permeability studies.
25416956 2014 A proteome-scale map of the human interactome network.
25037223 2014 The intestinal epithelial cell differentiation marker intestinal alkaline phosphatase (ALPi) is selectively induced by histone deacetylase inhibitors (HDACi) in colon cancer cells in a Kruppel-like factor 5 (KLF5)-dependent manner.
24586729 2014 Catalytic signature of a heat-stable, chimeric human alkaline phosphatase with therapeutic potential.
24506153 2014 Intestinal alkaline phosphatase: novel functions and protective effects.
23860652 2013 Modulators of intestinal alkaline phosphatase.
22783049 2012 Intestinal alkaline phosphatase in the colonic mucosa of children with inflammatory bowel disease.
22262031 2012 Decreased mucosal expression of intestinal alkaline phosphatase in children with coeliac disease.
More...