Property Summary

NCBI Gene PubMed Count 189
PubMed Score 6976.93
PubTator Score 7950.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Neutropenia 72 8.084 4.0
Thrombocytopenia 197 5.917 3.0
Anemia 365 5.745 2.9
Mucositis 29 5.497 2.7
Diarrhea 253 4.184 2.1
Stomatitis 21 3.994 2.0
Hepatic veno-occlusive disease 16 3.534 1.8
Abortion, Spontaneous 109 0.0 0.0
Agranulocytosis 6 0.0 0.0
Anemia, Aplastic 7 0.0 0.0
Arthralgia 90 0.0 0.0
Bone Marrow Neoplasms 1 0.0 0.0
Brain Injuries 65 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Carcinoma 11493 0.0 0.0
Carcinoma, Non-Small-Cell Lung 107 0.0 0.0
Carcinoma, Transitional Cell 32 0.0 0.0
Cardiomyopathy, Dilated 83 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Depressive disorder 409 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Disease Susceptibility 5 0.0 0.0
Drug-Related Side Effects and Adverse Reactions 62 0.0 0.0
Esophageal Neoplasms 69 0.0 0.0
Fever 138 0.0 0.0
Fibrosis 44 0.0 0.0
Gastrointestinal Diseases 12 0.0 0.0
Head and Neck Neoplasms 26 0.0 0.0
Headache 37 0.0 0.0
Heart Diseases 43 0.0 0.0
Heart failure 162 0.0 0.0
Hemangiosarcoma 18 0.0 0.0
Hodgkin Disease 15 0.0 0.0
Hyperbilirubinemia 4 0.0 0.0
Hypertrophy 17 0.0 0.0
Infarction 2 0.0 0.0
Kidney Diseases 114 0.0 0.0
Leiomyosarcoma 24 0.0 0.0
Leukemia, Myeloid, Acute 105 0.0 0.0
Leukopenia 72 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver Failure, Acute 29 0.0 0.0
Liver diseases 87 0.0 0.0
Liver neoplasms 130 0.0 0.0
Lymphoma, AIDS-Related 2 0.0 0.0
Lymphoma, B-Cell 6 0.0 0.0
Lymphoma, Non-Hodgkin 24 0.0 0.0
Melanoma 711 0.0 0.0
Multiple myeloma 1332 0.0 0.0
Muscle Weakness 170 0.0 0.0
Muscular Diseases 27 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Neoplasms, Second Primary 6 0.0 0.0
Nervous System Diseases 53 0.0 0.0
Pain 103 0.0 0.0
Pancytopenia 45 0.0 0.0
Peripheral Nervous System Diseases 52 0.0 0.0
Poisoning 16 0.0 0.0
Pulmonary Fibrosis 106 0.0 0.0
Scleroderma, Localized 3 0.0 0.0
Sepsis 24 0.0 0.0
Skin Neoplasms 69 0.0 0.0
Small Cell Lung Carcinoma 41 0.0 0.0
Soft Tissue Neoplasms 3 0.0 0.0
Somatosensory Disorders 2 0.0 0.0
Staphylococcal Infections 5 0.0 0.0
Stevens-Johnson syndrome 92 0.0 0.0
Urinary Bladder Neoplasms 114 0.0 0.0
Uterine Neoplasms 9 0.0 0.0
Ventricular Dysfunction, Left 22 0.0 0.0
Disease Target Count P-value
periodontitis 293 5.9e-25
non-small cell lung cancer 2890 2.1e-14
lung adenocarcinoma 2716 1.9e-06
osteosarcoma 7950 8.7e-06
lung cancer 4740 2.3e-04
psoriasis 6694 6.5e-04
invasive ductal carcinoma 2951 2.8e-02

Expression

  Differential Expression (7)

Disease log2 FC p
invasive ductal carcinoma -1.999 2.8e-02
lung adenocarcinoma -1.171 1.9e-06
lung cancer -2.200 2.3e-04
non-small cell lung cancer -2.080 2.1e-14
osteosarcoma 1.182 8.7e-06
periodontitis 1.300 5.9e-25
psoriasis 1.100 6.5e-04

Gene RIF (159)

AA Sequence

MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECA      1 - 70
TYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQ     71 - 140
LDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP       141 - 207
//

Text Mined References (192)

PMID Year Title