Property Summary

NCBI Gene PubMed Count 177
Grant Count 865
R01 Count 336
Funding $119,644,603.61
PubMed Score 6804.77
PubTator Score 7950.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (85)

Disease Z-score Confidence
Neutropenia 78 8.026 4.0
Cancer 2,346 6.666 3.3
Thrombocytopenia 105 5.962 3.0
Anemia 252 5.787 2.9
Pneumonia 133 4.378 2.2
Diarrhea 155 4.289 2.1
Alopecia 55 4.242 2.1
Stomatitis 19 3.988 2.0
Myocardial Infarction 126 3.877 1.9
Felty's syndrome 7 3.814 1.9
Neuropathy 210 3.713 1.9
Acquired immunodeficiency syndrome 164 3.596 1.8
Limb ischemia 12 3.516 1.8
Glycogen storage disease 37 3.397 1.7
Exanthem 39 3.374 1.7
Toxic encephalopathy 131 3.316 1.7
Heart disease 279 3.136 1.6
Cerebrovascular disease 231 3.11 1.6
Liver disease 219 3.048 1.5
Primary immunodeficiency disease 52 3.038 1.5
Adverse reaction to drug 54
Agranulocytosis 5
Aplastic anemia 18
Arthralgia 2
B-Cell Lymphomas 5
Bladder Neoplasm 109
Bone Marrow Neoplasms 1
Carcinoma, Transitional Cell 31
Cardiomyopathy, Dilated 47
Depressive disorder 48
Drug-Induced Liver Injury 118
Esophageal Neoplasms 67
Fever 34
Fibrosis 40
Gastrointestinal Diseases 12
Head and Neck Neoplasms 23
Headache 5
Heart Diseases 42
Heart failure 80
Hemangiosarcoma 18
Hepatic Veno-Occlusive Disease 2
Hodgkin Disease 16
Hyperbilirubinemia 4
Infarction 2
Inflammatory disease of mucous membrane 8
Kidney Diseases 86
Leiomyosarcoma 19
Leukemia, Myelocytic, Acute 113
Leukopenia 42
Liver Cirrhosis, Experimental 108
Liver Failure, Acute 22
Liver diseases 66
Liver neoplasms 109
Localized scleroderma 9
Lymphoma, AIDS-Related 2
Lymphoma, Non-Hodgkin 22
Mammary Neoplasms 410
Melanoma 261
Multiple myeloma 1,327
Muscle Weakness 92
Myopathy 128
Neoplasm Metastasis 138
Neoplasms, Second Primary 6
Pain 70
Pancytopenia 9
Peripheral Neuropathy 303
Pulmonary Fibrosis 66
Sepsis 21
Skin Neoplasms 49
Small cell carcinoma of lung 45
Soft Tissue Neoplasms 3
Somatosensory Disorders 2
Spontaneous abortion 108
Stevens-Johnson syndrome 78
Uterine Neoplasms 7
Ventricular Dysfunction, Left 15
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
nervous system disorder 53
non-small cell lung cancer 2,798
non-small cell lung carcinoma 413
osteosarcoma 7,933
periodontitis 269
psoriasis 6,685

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 3.400 0.000
osteosarcoma 1.182 0.000
periodontitis 1.300 0.000
non-small cell lung cancer -2.080 0.000
lung cancer -4.300 0.000
invasive ductal carcinoma -1.999 0.028
lung adenocarcinoma -1.171 0.000

Synonym

Accession P09919 A8MXR7 G-CSF
Symbols GCSF
CSF3OS
C17orf33

Gene

PANTHER Protein Class (2)

PDB

1CD9   1GNC   1PGR   1RHG   2D9Q  

Gene RIF (146)

PMID Text
26992288 G-CSF stimulates beta1 integrin expression and Swan 71 cell migration by activating PI3K and MAPK signaling pathways.
26666576 tumor G-CSF expression is an indicator of an extremely poor prognosis in cervical cancer patients that are treated with chemotherapy.
25976379 these data suggest that G-CSF may contribute to tumor growth and decrease the antitumor effect of radiotherapy, possibly by promoting vascularization in cancer lesions.
25721620 Colony Stimulating Factors 1, 2, 3 and early pregnancy
25510103 Transgenic poultry with a gene of human granulocyte colony-stimulating factor (gcsf) was developed by arti- ficial insemination with the transfected sperm
25400792 Case Report: undifferentiated colon carcinoma producing G-CSF.
25389911 GM-CSF, through its stimulatory function on macrophages, may promote aneurysm progression.
25249155 increases MMP-2 activity and VEGF secretion in trophoblasts through activation of PI3K/Akt and Erk signaling pathways
24994458 Elevated IL-8 and G-CSF may be involved in the pathophysiology of narcolepsy.
24975135 G-CSF constrains cancer to grow and progress by, respectively, supporting the survival of sympathetic nerve fibers in 6-hydroxydopamine-sympathectomized mice.
More...

AA Sequence

MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECA      1 - 70
TYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQ     71 - 140
LDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP       141 - 207
//

Text Mined References (180)

PMID Year Title
26992288 2016 Granulocyte colony-stimulating factor (G-CSF) upregulates ?1 integrin and increases migration of human trophoblast Swan 71 cells via PI3K and MAPK activation.
26666576 2015 The significance of G-CSF expression and myeloid-derived suppressor cells in the chemoresistance of uterine cervical cancer.
25976379 2015 Administration of granulocyte colony-stimulating factor with radiotherapy promotes tumor growth by stimulating vascularization in tumor-bearing mice.
25721620 2015 Colony Stimulating Factors 1, 2, 3 and early pregnancy steps: from bench to bedside.
25510103 [Development of transgenic chicken with a gene of human granulocyte colony-stimulating factor using sperm-mediated gene transfer].
25400792 2014 Granulocyte colony-stimulating factor-producing undifferentiated carcinoma of the colon mimicking a pulmonary giant cell carcinoma: a case showing overexpression of CD44 along with highly proliferating nestin-positive tumor vessels.
25389911 2015 Potential role of granulocyte-monocyte colony-stimulating factor in the progression of intracranial aneurysms.
25249155 2014 The granulocyte colony-stimulating factor (G-CSF) upregulates metalloproteinase-2 and VEGF through PI3K/Akt and Erk1/2 activation in human trophoblast Swan 71 cells.
24994458 2014 Increased plasma IL-6, IL-8, TNF-alpha, and G-CSF in Japanese narcolepsy.
24975135 2015 Granulocyte colony-stimulating factor off-target effect on nerve outgrowth promotes prostate cancer development.
More...