Property Summary

Ligand Count 752
NCBI Gene PubMed Count 263
PubMed Score 1408.88
PubTator Score 1830.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma -2.125 2.3e-03
astrocytoma 2.500 3.8e-02
Astrocytoma, Pilocytic 1.500 2.2e-04
Breast cancer -2.100 7.0e-08
chronic kidney disease 2.500 4.1e-03
cystic fibrosis -1.200 5.5e-04
dermatomyositis 1.400 2.2e-03
Endometriosis -1.173 3.7e-02
glioblastoma 3.000 1.2e-04
group 3 medulloblastoma -1.900 6.6e-03
interstitial cystitis -1.400 3.3e-03
invasive ductal carcinoma 2.442 3.6e-05
lung adenocarcinoma -1.500 6.3e-07
lung cancer -4.400 3.1e-05
lung carcinoma -2.100 3.8e-19
medulloblastoma, large-cell -2.900 3.2e-04
mucosa-associated lymphoid tissue lympho... 2.068 1.1e-02
non-small cell lung cancer -1.945 1.1e-20
osteosarcoma -3.644 1.3e-03
ovarian cancer -2.300 1.1e-03
pancreatic ductal adenocarcinoma liver m... 2.241 3.0e-02
periodontitis 1.100 9.4e-22
primary Sjogren syndrome 2.000 3.6e-04
psoriasis 1.100 9.2e-03
ulcerative colitis 3.400 5.2e-08

Gene RIF (247)

AA Sequence

MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRI      1 - 70
EKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQ     71 - 140
KQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEK    141 - 210
IFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQG    211 - 280
NIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLL    281 - 350
AKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG    351 - 420
LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVV    421 - 490
DIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYD    491 - 560
WCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKP    561 - 630
VKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI                              631 - 674
//

Text Mined References (267)

PMID Year Title