Property Summary

NCBI Gene PubMed Count 246
PubMed Score 1353.02
PubTator Score 1830.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 8.82508839576068E-22
periodontitis 269 9.41987998047392E-22
lung carcinoma 2844 3.76259360643318E-19
Breast cancer 3099 6.96942217238894E-8
ovarian cancer 8492 9.32787141423589E-6
cystic fibrosis 1670 1.18937640142294E-5
lung cancer 4473 3.05909427565998E-5
invasive ductal carcinoma 2950 3.64238474976528E-5
interstitial cystitis 2299 6.1877612633586E-5
glioblastoma 5572 1.15628633267717E-4
group 4 medulloblastoma 1875 2.09393466646144E-4
lung adenocarcinoma 2714 2.17145907295995E-4
pilocytic astrocytoma 3086 2.24066434406686E-4
medulloblastoma, large-cell 6234 3.18354375031629E-4
primary Sjogren syndrome 789 3.6117143558588E-4
osteosarcoma 7933 0.00128008985353566
dermatomyositis 967 0.00224624597077531
adrenocortical carcinoma 1427 0.0023013132215851
chronic kidney disease 90 0.00409214453205619
psoriasis 6685 0.00919139876750432
mucosa-associated lymphoid tissue lymphoma 480 0.0106248602216347
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0295918552573706
Endometriosis 535 0.0372671837530439
astrocytoma 1493 0.0384064825621469
Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (25)

Disease log2 FC p
psoriasis 1.100 0.009
glioblastoma 3.000 0.000
osteosarcoma -3.644 0.001
group 4 medulloblastoma -2.000 0.000
astrocytoma 2.500 0.038
periodontitis 1.100 0.000
medulloblastoma, large-cell -2.900 0.000
adrenocortical carcinoma -2.125 0.002
chronic kidney disease 2.500 0.004
pancreatic ductal adenocarcinoma liver m... 2.241 0.030
non-small cell lung cancer -3.025 0.000
lung cancer -4.400 0.000
interstitial cystitis -2.100 0.000
cystic fibrosis -2.700 0.000
pilocytic astrocytoma 1.500 0.000
primary Sjogren syndrome 2.000 0.000
lung adenocarcinoma -2.001 0.000
invasive ductal carcinoma 2.442 0.000
Endometriosis -1.173 0.037
lung carcinoma -2.100 0.000
Breast cancer -2.100 0.000
mucosa-associated lymphoid tissue lympho... 2.068 0.011
ulcerative colitis 3.400 0.000
ovarian cancer 3.500 0.000
dermatomyositis 1.400 0.002

Synonym

Accession P09917 B7ZLS0 E5FPY5 E5FPY7 E5FPY8 Q5JQ14 5-LO
Symbols 5-LO
5LPG
LOG5
5-LOX

Gene

PANTHER Protein Class (2)

PDB

2ABV   3O8Y   3V92   3V98   3V99  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (231)

PMID Text
26852002 the Alox-5 gene might play a role in the differentiation of multiple drug resistant and non-resistant erythroleukemic cell lines
26707712 our data suggest that the inhibition of both COX-2/5-LOX may be an effective therapeutic approach for colon cancer management, particularly for those patients with high expression of COX-2/5-LOX
26505400 we identified differences in the frequency distribution in the Tibetan population located in the ALOX5 , VKORC1 and PTGS2 genes
26427761 The study explores the substrate access portal of 5-Lipoxygenase.
26378572 Increased PUFA Content and 5-lipoxygenase pathway expression are associated with subcutaneous adipose tissue inflammation in obese women with type 2 diabetes.
26334317 These results suggest that COX-2 and 5-LO play roles in tumorigenesis and the progression of primary glioblastoma and that the co-expression pattern of COX-2/5-LO may be used as an independent prognostic factor in this disease.
26329759 AF4 and AF4-MLL mediate transcriptional elongation of 5-lipoxygenase mRNA by 1, 25-dihydroxyvitamin D3.
26327594 THE 5-LOX interface involving the four cysteines 159, 300, 416 and 418 is important for the translocation to the nuclear membrane and the colocalization with FLAP.
26210919 The study shows that 5-lipoxygenase (5-LO) in B cells is phosphorylated on Ser523 and demonstrates for the first time a chemical difference between 5-LO in myeloid cells and B cells.
26173130 investigated potential mechanisms by which 5-LO13 interferes with 5-LO product biosynthesis in transfected HEK293 cells
More...

AA Sequence

MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRI      1 - 70
EKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQ     71 - 140
KQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEK    141 - 210
IFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQG    211 - 280
NIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLL    281 - 350
AKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG    351 - 420
LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVV    421 - 490
DIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYD    491 - 560
WCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKP    561 - 630
VKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI                              631 - 674
//

Text Mined References (250)

PMID Year Title
26852002 2016 Cell differentiation and the multiple drug resistance phenotype in human erythroleukemic cells.
26707712 2016 Dual inhibition of COX-2/5-LOX blocks colon cancer proliferation, migration and invasion in vitro.
26505400 2015 Genetic polymorphisms in very important pharmacogenomic (VIP) variants in the Tibetan population.
26427761 2015 Identification of the Substrate Access Portal of 5-Lipoxygenase.
26378572 2015 Increased PUFA Content and 5-Lipoxygenase Pathway Expression Are Associated with Subcutaneous Adipose Tissue Inflammation in Obese Women with Type 2 Diabetes.
26334317 2015 Co-expression of COX-2 and 5-LO in primary glioblastoma is associated with poor prognosis.
26329759 2015 AF4 and AF4-MLL mediate transcriptional elongation of 5-lipoxygenase mRNA by 1, 25-dihydroxyvitamin D3.
26327594 2015 Characterization of the interaction of human 5-lipoxygenase with its activating protein FLAP.
26210919 2015 Phosphorylation of serine 523 on 5-lipoxygenase in human B lymphocytes.
26173130 2015 The Intracellular Localisation and Phosphorylation Profile of the Human 5-Lipoxygenase ?13 Isoform Differs from That of Its Full Length Counterpart.
More...