Property Summary

NCBI Gene PubMed Count 48
Grant Count 47
R01 Count 28
Funding $6,151,012.24
PubMed Score 85.70
PubTator Score 472.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
systemic lupus erythematosus 2.500 0.000
malignant mesothelioma 3.000 0.000
psoriasis 2.300 0.005
cutaneous lupus erythematosus 4.100 0.000
group 4 medulloblastoma -2.800 0.000
cystic fibrosis 2.600 0.002
medulloblastoma, large-cell -3.700 0.000
juvenile dermatomyositis 3.566 0.000
intraductal papillary-mucinous neoplasm ... 2.000 0.024
lung cancer -3.100 0.000
pancreatic cancer 1.400 0.003
fibroadenoma -1.500 0.015
Multiple Sclerosis 3.500 0.003
lung adenocarcinoma -1.100 0.000
primary Sjogren syndrome 2.600 0.000
nasopharyngeal carcinoma 1.800 0.012
Breast cancer 1.500 0.007
ovarian cancer 2.800 0.002
dermatomyositis 2.400 0.017

Gene RIF (24)

PMID Text
26157117 IFIT1 is not a dominant restriction factor against three different families of negative-sense RNA viruses.
26116899 HIV-1 Vpr upregulates the gene expression of IFIT1 in human monocyte-derived dendritic cells
25905045 Reovirus T3D infection induced STAT-1, ISG-15, IFIT-1, Mx1, and IFIT-3 expression.
25170834 HIV-1 Vpr upregulates the gene expression of IFIT1 in human monocyte-derived dendritic cells
24196705 HIV-1 Vpr upregulates the gene expression of IFIT1 in human monocyte-derived dendritic cells
24098121 The specificity of IFIT1 for 2'O-unmethylated RNA serves as potent antiviral mechanism against viruses lacking 2'O-methyltransferase activity and at the same time allows unperturbed progression of the antiviral program in infected cells.
23867918 Data show that interferon-induced proteins with tetratricopeptide repeats 1 and 2 (IFIT1 and IFIT2) contribute to the regulation of hepatitis B virus (HBV) replication, likely at both transcriptional and posttranscriptional steps.
23785202 Results indicate that miR-203 is an interferon-inducible miRNA that can negatively regulate a number of cellular mRNAs, including an interferon-stimulated gene target, IFIT1/ISG56, by destabilizing its mRNA transcript.
23684765 TLR4 signaling, induced by LPS, increases the expression of melanoma differentiation-associated gene 5 (MDA5) and interferon
23529855 protein expression is inhibited by hepatitis C virus
More...

AA Sequence

MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAYVKHLKGQNEE      1 - 70
ALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPE     71 - 140
IDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATKNHKPFSLLPLRQAV    141 - 210
RLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQE    211 - 280
TPTSVLLHHQIGLCYKAQMIQIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMY    281 - 350
IEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN    351 - 420
SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP                421 - 478
//

Text Mined References (53)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26157117 2015 Human and Murine IFIT1 Proteins Do Not Restrict Infection of Negative-Sense RNA Viruses of the Orthomyxoviridae, Bunyaviridae, and Filoviridae Families.
25905045 2015 Comparative proteomic analyses demonstrate enhanced interferon and STAT-1 activation in reovirus T3D-infected HeLa cells.
25416956 2014 A proteome-scale map of the human interactome network.
24098121 2013 Sequestration by IFIT1 impairs translation of 2'O-unmethylated capped RNA.
23867918 2014 Interferon-induced proteins with tetratricopeptide repeats 1 and 2 are cellular factors that limit hepatitis B virus replication.
23785202 2013 MicroRNA profiling of Sendai virus-infected A549 cells identifies miR-203 as an interferon-inducible regulator of IFIT1/ISG56.
23684765 2013 MDA5 and ISG56 mediate CXCL10 expression induced by toll-like receptor 4 activation in U373MG human astrocytoma cells.
23529855 2014 Hepatitis C virus impairs TLR3 signaling and inhibits IFN-? 1 expression in human hepatoma cell line.
23363937 2013 Interaction between interferon-stimulated gene 56 and melanoma differentiation-associated gene 5 in Toll-like receptor 3 signaling in normal human mesangial cells.
More...