Property Summary

NCBI Gene PubMed Count 55
PubMed Score 92.94
PubTator Score 472.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Systemic lupus erythematosus 2.500 1.7e-04
Breast cancer 1.500 7.2e-03
cutaneous lupus erythematosus 4.100 1.6e-06
cystic fibrosis 1.492 4.4e-04
dermatomyositis 2.400 1.7e-02
fibroadenoma -1.500 1.5e-02
group 3 medulloblastoma -2.700 2.2e-06
intraductal papillary-mucinous neoplasm ... 2.000 2.4e-02
juvenile dermatomyositis 3.566 3.0e-22
lung adenocarcinoma -1.100 6.4e-08
lung cancer -2.600 1.4e-04
malignant mesothelioma 3.000 1.1e-08
medulloblastoma, large-cell -3.700 3.5e-06
Multiple Sclerosis 3.500 3.4e-03
nasopharyngeal carcinoma 1.800 1.2e-02
ovarian cancer -1.500 3.4e-02
pancreatic cancer 1.400 3.4e-03
primary Sjogren syndrome 2.600 1.4e-04
psoriasis 2.200 1.1e-06

Gene RIF (32)

AA Sequence

MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAYVKHLKGQNEE      1 - 70
ALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPE     71 - 140
IDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATKNHKPFSLLPLRQAV    141 - 210
RLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQE    211 - 280
TPTSVLLHHQIGLCYKAQMIQIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMY    281 - 350
IEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN    351 - 420
SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP                421 - 478
//

Text Mined References (60)

PMID Year Title