Property Summary

NCBI Gene PubMed Count 21
PubMed Score 16.00
PubTator Score 69.99

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P09912 Q13141 Q13142 Q5VVR2 Q5VVR3 Q6IE95 Q969M8
Symbols 6-16
G1P3
FAM14C
IFI616
IFI-6-16

Gene

Gene RIF (11)

PMID Text
26116899 HIV-1 Vpr upregulates the gene expression of IFI6 in human monocyte-derived dendritic cells
26105982 In conclusion, over-expression of IFI6 promotes hepatitis C virus RNA replication and rescues the interferon alpha-mediated anti-hepatitis C virus activity.
25757571 IFI6 inhibits HCV entry by impairing EGFR mediated CD81/CLDN1 interactions. This may be relevant to other virus entry processes employing EGFR.
24162774 HIV-1 Vpr upregulates the gene expression of IFI6 in human monocyte-derived dendritic cells
21996729 Here we elucidate G1P3, a survival protein induced by interferons (IFNs), as a target of estrogen signaling and a contributor to poor outcomes in estrogen receptor-positive (ER(+)) breast cancer.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20377629 PRINS regulates G1P3, a gene with anti-apoptotic effects in keratinocytes. siRNA-mediated inhibition of PRINS gene resulted in altered cell morphology and gene expression alterations.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18838000 Respiratory syncytial virus upregulated the mRNA expression of chemokines CC and CXC and interfered with type alpha/beta interferon-inducible gene expression by upregulation of MG11 and downregulation of G1P3.
17823654 IFN-alpha2b induced the expression of G1P3 and antagonized the TRAIL induced apoptosis in myeloma suggesting that either the deregulated or the induced expression of G1P3 could lead to apoptosis resistance in tumor cells.
More...

AA Sequence

MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANS      1 - 70
VAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE               71 - 130
//

Text Mined References (23)

PMID Year Title
26105982 2016 Interferon-inducible Protein 6-16 (IFI-6-16, ISG16) promotes Hepatitis C virus replication in vitro.
25757571 2015 Interferon-? inducible protein 6 impairs EGFR activation by CD81 and inhibits hepatitis C virus infection.
25539662 2014 No transmission of hepatitis E virus in pigs fed diets containing commercial spray-dried porcine plasma: a retrospective study of samples from several swine trials.
21996729 2012 G1P3, an interferon- and estrogen-induced survival protein contributes to hyperplasia, tamoxifen resistance and poor outcomes in breast cancer.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20377629 2010 The anti-apoptotic protein G1P3 is overexpressed in psoriasis and regulated by the non-coding RNA, PRINS.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18838000 2008 Inhibition of G1P3 expression found in the differential display study on respiratory syncytial virus infection.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17823654 2007 G1P3, an IFN-induced survival factor, antagonizes TRAIL-induced apoptosis in human myeloma cells.
More...