Property Summary

NCBI Gene PubMed Count 73
Grant Count 26
R01 Count 15
Funding $1,924,259.98
PubMed Score 244.41
PubTator Score 1157.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
glioblastoma 1.300 0.000
group 3 medulloblastoma 1.900 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.400 0.000
primitive neuroectodermal tumor 1.200 0.000
tuberculosis 1.800 0.000
colon cancer 1.100 0.018
pediatric high grade glioma 1.100 0.000

 MGI Term (1)

Gene RIF (20)

PMID Text
27019227 Data indicate that X-linked reticulate pigmentary disorder (XLPDR) is caused by an intronic mutation that disrupts the expression of POLA1, which encodes the catalytic subunit of DNA polymerase-alpha.
27019227 Mutation in POLA1 is responsible for XLPDR (MIM: 312040) and demonstrates a role for this gene in interferon regulation
25924900 Inhibition of DNA polymerases a, delra and e by AFP promoter-driven artificial microRNAs may lead to effective growth arrest of AFP-positive HCC cells,as novel strategy for gene therapy
25847248 To understand the regulatory mechanisms and to reveal the details of DNA polymerase alpha organization, the study determined the crystal structure of p70 in complex with C terminus of the POLA catalytic subunit (p180C).
24962573 the N-terminal domain of the large subunit of primase (p58N) directly interacts with the C-terminal domain of the catalytic subunit of polalpha (p180C)
22918585 The Pol alpha-primase complex.
22887995 Pol epsilon and Pol alpha/delta seem to pursue their functions at least in part independently in late S phase
22679391 Depletion of p180 in U2OS cells increases cell size.
22593576 Findings indicate that tethering of primase to the replisome by DNA polymerase alpha (pol alpha) is critical for the normal action of DNA replication forks in eukaryotic cells.
19608746 DNA and p180 binding to an Mcm10 construct that contains both the ID and CTD, provide the first mechanistic insight into how Mcm10 might use a handoff mechanism to load and stabilize pol alpha within the replication fork.
More...

AA Sequence

MAPVHGDDSLSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEEVDEEQYSKLV      1 - 70
QARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAVTKPNNIKSMFIA     71 - 140
CAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASP    141 - 210
VSRKEPPLTPVPLKRAEFAGDDVQVESTEEEQESGAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEPA    211 - 280
EEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYE    281 - 350
DQYNQPGVVFLFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEK    351 - 420
IATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFLMN    421 - 490
RKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQNAKNHQNEIIAM    491 - 560
AALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKKNVKVEVAATERTLLGFFLAKVHKID    561 - 630
PDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRSNMPKLGGRSGFGERNATCGRMICDVEISAKEL    631 - 700
IRCKSYHLSELVQQILKTERVVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITN    701 - 770
IAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKAAYA    771 - 840
GGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASEAQKVTEDGEQEQIPELPDPSLEMGI    841 - 910
LPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKG    911 - 980
REILMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLL    981 - 1050
KKKKYAALVVEPTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIG   1051 - 1120
ENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTASQ   1121 - 1190
RAYAPEQLQKQDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDAL   1191 - 1260
LGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKL   1261 - 1330
IMDIRRFIKKYYDGWLICEEPTCRNRTRHLPLQFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFD   1331 - 1400
AECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS           1401 - 1462
//

Text Mined References (81)

PMID Year Title
27019227 2016 DNA polymerase-? regulates the activation of type I interferons through cytosolic RNA:DNA synthesis.
25924900 2015 DNA Polymerases as targets for gene therapy of hepatocellular carcinoma.
25847248 2015 Crystal Structure of the Human Pol ? B Subunit in Complex with the C-terminal Domain of the Catalytic Subunit.
24962573 2014 The C-terminal domain of the DNA polymerase catalytic subunit regulates the primase and polymerase activities of the human DNA polymerase ?-primase complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22918585 2012 The Pol ?-primase complex.
22887995 2012 Segregation of replicative DNA polymerases during S phase: DNA polymerase ?, but not DNA polymerases ?/?, are associated with lamins throughout S phase in human cells.
22679391 2012 p180 promotes the ribosome-independent localization of a subset of mRNA to the endoplasmic reticulum.
22593576 2012 A conserved motif in the C-terminal tail of DNA polymerase ? tethers primase to the eukaryotic replisome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...