Property Summary

NCBI Gene PubMed Count 57
Grant Count 27
R01 Count 9
Funding $2,336,402.59
PubMed Score 918.86
PubTator Score 483.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (49)

Disease Z-score Confidence
Angioedema 36 6.375 3.2
Complement deficiency 15 4.431 2.2
Lupus erythematosus 80 4.399 2.2
Nephritis 29 3.436 1.7
Rheumatoid Arthritis 1,160 3.081 1.5
Atopic dermatitis 944
Autoimmune Diseases 33
Becker muscular dystrophy 187
Complement 1s deficiency 1
Duchenne muscular dystrophy 602
Ehlers-Danlos syndrome 42 4.0
Hashimoto Disease 2
Hepatitis, Autoimmune 17
Hereditary Angioedema Types I and II 2
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
autosomal dominant Emery-Dreifuss muscul... 499 
chronic kidney disease 90
colon cancer 1,475
cystic fibrosis 1,665
dermatomyositis 933
diabetes mellitus 1,663
esophageal adenocarcinoma 737
gastric carcinoma 832
glioblastoma 5,572
head and neck cancer and chronic obstruc... 237 
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

  Differential Expression (38)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
538 screening 102 / 0 / 62035 Complement factor C1s
787 confirmatory 23 / 1 / 160 Complement factor C1s IC50 from mixture screen
829 confirmatory 0 / 0 / 21 Complement C1s ELISA

Gene RIF (15)

PMID Text
26231209 C1q exists as the C1 complex (C1qC1r2C1s2), and C1q binding to ligands activates the C1r/C1s proteases. Incubation of nucleoli with C1 caused degradation of the nucleolar proteins nucleolin and nucleophosmin 1. T
24695853 TNT003, an inhibitor of the serine protease C1s, prevents complement activation induced by cold agglutinins.
23989031 Data indicate that complement C1s mRNA level was low in ICR-derived glomerulonephritis (ICGN) mice liver as compared with age-matched ICR mice.
23650384 Analysis of its interaction properties by surface plasmon resonance shows that rC1q retains the ability of serum C1q to associate with the C1s-C1r-C1r-C1s tetramer, to recognize physiological C1q ligands such as IgG and pentraxin 3
23592783 A molecular switch governs the interaction between the human complement protease C1s and its substrate, complement C4.
22855709 Four positively charged amino acids on the serine protease domain appear to form a catalytic exosite that is required for efficient cleavage of C4 in the classical pathway of complement.
20592021 These results provide further structural insights into the architecture of the C1 complex, and the interactions between C1r and C1s.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20008834 Detailed mapping of post-translational modifications and insights into the C1r/C1s binding sites.
More...

AA Sequence

MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIELSENCAYDSV      1 - 70
QIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERFTGFAAYYVATDINECTDFVD     71 - 140
VPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEK    141 - 210
GFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQK    211 - 280
KGWKLRYHGDPMPCPKEDTPNSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNS    281 - 350
KLKCQPVDCGIPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK    351 - 420
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGNREPTMYVGST    421 - 490
SVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDYNLM    491 - 560
DGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAGGEKGMDSCKG    561 - 630
DSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGLYTRVKNYVDWIMKTMQENSTPRED                631 - 688
//

Text Mined References (59)

PMID Year Title
26231209 2015 C1q protein binds to the apoptotic nucleolus and causes C1 protease degradation of nucleolar proteins.
24695853 2014 TNT003, an inhibitor of the serine protease C1s, prevents complement activation induced by cold agglutinins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23989031 2013 Gene expression analysis detected a low expression level of C1s gene in ICR-derived glomerulonephritis (ICGN) mice.
23650384 2013 Expression of recombinant human complement C1q allows identification of the C1r/C1s-binding sites.
23592783 2013 A molecular switch governs the interaction between the human complement protease C1s and its substrate, complement C4.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22855709 2012 Identification of a catalytic exosite for complement component C4 on the serine protease domain of C1s.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
20592021 2010 Mapping surface accessibility of the C1r/C1s tetramer by chemical modification and mass spectrometry provides new insights into assembly of the human C1 complex.
More...