Property Summary

NCBI Gene PubMed Count 126
Grant Count 168
R01 Count 38
Funding $40,706,002.43
PubMed Score 420.19
PubTator Score 1418.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 0.000
psoriasis -1.100 0.000

Synonym

Accession P09848 Q4ZG58
Symbols LAC
LPH
LPH1

Gene

LCT

PANTHER Protein Class (2)

Gene RIF (131)

PMID Text
26334798 The frequency of -13910*T was significantly higher among the Mennonites when compared to the Euro-Brazilian cohort. Accordingly, Mennonites had a higher prevalence of the lactase persistence genotype
26054462 Diversity of lactase persistence in African milk drinkers.
25853887 Populations from two medieval sites in Central Poland, Stary Brzesc Kujawski-4 (SBK-4) and Gruczno, represented high level of lactase persistence (LP) as followed by the LCT-13910*T allele's presence (0.86 and 0.82, respectively).
25651731 Report reliabile of the single nucleotide polymorphism of lactase persistence LPH(-13910) C/T from saliva derived DNA.
25625576 In conclusion, our data indicate that identification of a -13910C/C genotype is likely to predict the presence of lactase nonpersistence, in keeping with prior published studies.
24704072 Evidence of selection around the LCT gene among Khoe-speaking groups, and the substantial frequency of the 14010C variant among the Nama is best explained by adaptation to digesting milk.
24465990 Evolutionary history of the European lactase persistence trait and its global cultural implications.
24448642 Genotypes of neolithic human remains indicate that natural selection models satisfy the observed increase in allele frequency in lactase persistence.
23993196 The LCT enhancer sequence in a large lactose-tolerance-tested Ethiopian cohort of more than 350 individuals, was examined.
23985982 The findings of this study suggest that at least the ApaI and BsmI polymorphisms of the VDR gene and T-13910C of the LCT gene are associated with the risk of postmenopausal osteoporosis in our sample of the Belarusian women.
More...

AA Sequence

MELSWHVVFIALLSFSCWGSDWESDRNFISTAGPLTNDLLHNLSGLLGDQSSNFVAGDKDMYVCHQPLPT      1 - 70
FLPEYFSSLHASQITHYKVFLSWAQLLPAGSTQNPDEKTVQCYRRLLKALKTARLQPMVILHHQTLPAST     71 - 140
LRRTEAFADLFADYATFAFHSFGDLVGIWFTFSDLEEVIKELPHQESRASQLQTLSDAHRKAYEIYHESY    141 - 210
AFQGGKLSVVLRAEDIPELLLEPPISALAQDTVDFLSLDLSYECQNEASLRQKLSKLQTIEPKVKVFIFN    211 - 280
LKLPDCPSTMKNPASLLFSLFEAINKDQVLTIGFDINEFLSCSSSSKKSMSCSLTGSLALQPDQQQDHET    281 - 350
TDSSPASAYQRIWEAFANQSRAERDAFLQDTFPEGFLWGASTGAFNVEGGWAEGGRGVSIWDPRRPLNTT    351 - 420
EGQATLEVASDSYHKVASDVALLCGLRAQVYKFSISWSRIFPMGHGSSPSLPGVAYYNKLIDRLQDAGIE    421 - 490
PMATLFHWDLPQALQDHGGWQNESVVDAFLDYAAFCFSTFGDRVKLWVTFHEPWVMSYAGYGTGQHPPGI    491 - 560
SDPGVASFKVAHLVLKAHARTWHHYNSHHRPQQQGHVGIVLNSDWAEPLSPERPEDLRASERFLHFMLGW    561 - 630
FAHPVFVDGDYPATLRTQIQQMNRQCSHPVAQLPEFTEAEKQLLKGSADFLGLSHYTSRLISNAPQNTCI    631 - 700
PSYDTIGGFSQHVNHVWPQTSSSWIRVVPWGIRRLLQFVSLEYTRGKVPIYLAGNGMPIGESENLFDDSL    701 - 770
RVDYFNQYINEVLKAIKEDSVDVRSYIARSLIDGFEGPSGYSQRFGLHHVNFSDSSKSRTPRKSAYFFTS    771 - 840
IIEKNGFLTKGAKRLLPPNTVNLPSKVRAFTFPSEVPSKAKVVWEKFSSQPKFERDLFYHGTFRDDFLWG    841 - 910
VSSSAYQIEGAWDADGKGPSIWDNFTHTPGSNVKDNATGDIACDSYHQLDADLNMLRALKVKAYRFSISW    911 - 980
SRIFPTGRNSSINSHGVDYYNRLINGLVASNIFPMVTLFHWDLPQALQDIGGWENPALIDLFDSYADFCF    981 - 1050
QTFGDRVKFWMTFNEPMYLAWLGYGSGEFPPGVKDPGWAPYRIAHAVIKAHARVYHTYDEKYRQEQKGVI   1051 - 1120
SLSLSTHWAEPKSPGVPRDVEAADRMLQFSLGWFAHPIFRNGDYPDTMKWKVGNRSELQHLATSRLPSFT   1121 - 1190
EEEKRFIRATADVFCLNTYYSRIVQHKTPRLNPPSYEDDQEMAEEEDPSWPSTAMNRAAPWGTRRLLNWI   1191 - 1260
KEEYGDIPIYITENGVGLTNPNTEDTDRIFYHKTYINEALKAYRLDGIDLRGYVAWSLMDNFEWLNGYTV   1261 - 1330
KFGLYHVDFNNTNRPRTARASARYYTEVITNNGMPLAREDEFLYGRFPEGFIWSAASAAYQIEGAWRADG   1331 - 1400
KGLSIWDTFSHTPLRVENDAIGDVACDSYHKIAEDLVTLQNLGVSHYRFSISWSRILPDGTTRYINEAGL   1401 - 1470
NYYVRLIDTLLAASIQPQVTIYHWDLPQTLQDVGGWENETIVQRFKEYADVLFQRLGDKVKFWITLNEPF   1471 - 1540
VIAYQGYGYGTAAPGVSNRPGTAPYIVGHNLIKAHAEAWHLYNDVYRASQGGVISITISSDWAEPRDPSN   1541 - 1610
QEDVEAARRYVQFMGGWFAHPIFKNGDYNEVMKTRIRDRSLAAGLNKSRLPEFTESEKRRINGTYDFFGF   1611 - 1680
NHYTTVLAYNLNYATAISSFDADRGVASIADRSWPDSGSFWLKMTPFGFRRILNWLKEEYNDPPIYVTEN   1681 - 1750
GVSQREETDLNDTARIYYLRTYINEALKAVQDKVDLRGYTVWSAMDNFEWATGFSERFGLHFVNYSDPSL   1751 - 1820
PRIPKASAKFYASVVRCNGFPDPATGPHACLHQPDAGPTISPVRQEEVQFLGLMLGTTEAQTALYVLFSL   1821 - 1890
VLLGVCGLAFLSYKYCKRSKQGKTQRSQQELSPVSSF                                    1891 - 1927
//

Text Mined References (127)

PMID Year Title
26334798 2016 The Frequency of the LCT*-13910C>T Polymorphism Associated with Lactase Persistence Diverges among Euro-Descendant Groups from Brazil.
26054462 2015 Diversity of lactase persistence in African milk drinkers.
25853887 2015 Hunting for the LCT-13910*T allele between the Middle Neolithic and the Middle Ages suggests its absence in dairying LBK people entering the Kuyavia region in the 8th millennium BP.
25651731 2014 Reliable analysis of the single nucleotide polymorphism of lactase persistence LPH(-13910) C/T from saliva derived DNA: validation of a standardized saliva collection system.
25625576 2015 Functional significance of single nucleotide polymorphisms in the lactase gene in diverse US patients and evidence for a novel lactase persistence allele at -13909 in those of European ancestry.
24704072 2014 Lactase persistence alleles reveal partial East African ancestry of southern African Khoe pastoralists.
24465990 2014 Ancient DNA analysis reveals high frequency of European lactase persistence allele (T-13910) in medieval central europe.
24448642 2014 Direct estimates of natural selection in Iberia indicate calcium absorption was not the only driver of lactase persistence in Europe.
23993196 2013 Diversity of lactase persistence alleles in Ethiopia: signature of a soft selective sweep.
23985982 2013 Association Between Polymorphisms of VDR, COL1A1, and LCT genes and bone mineral density in Belarusian women with severe postmenopausal osteoporosis.
More...