Property Summary

Ligand Count 17
NCBI Gene PubMed Count 77
PubMed Score 226.92
PubTator Score 142.07

Knowledge Summary

Patent (52,062)

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -2.100 3.9e-02
Chronic Lymphocytic Leukemia 1.408 1.2e-03
cutaneous lupus erythematosus 1.200 9.0e-03
interstitial cystitis 1.500 1.9e-03
lung adenocarcinoma -2.200 1.0e-11
lung cancer -2.600 4.0e-03
lung carcinoma -1.900 7.1e-23
mucosa-associated lymphoid tissue lympho... 1.849 1.2e-02
non-small cell lung cancer -2.616 1.4e-27
osteosarcoma -3.653 3.8e-05
ulcerative colitis 1.700 3.3e-04
Waldenstrons macroglobulinemia -1.036 5.5e-03

 GWAS Trait (1)

Gene RIF (9)

AA Sequence

MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGT      1 - 70
IRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSSGKTGCIPSNYVAPVDSIQ     71 - 140
AEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGGYYI    141 - 210
TTRVQFNSVQELVQHYMEVNDGLCNLLIAPCTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLG    211 - 280
TWNGSTKVAVKTLKPGTMSPKAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPE    281 - 350
GQDLRLPQLVDMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF    351 - 420
PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCPPGCPASLYEA    421 - 490
MEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT                                   491 - 529
//

Text Mined References (82)

PMID Year Title