Property Summary

NCBI Gene PubMed Count 75
PubMed Score 216.29
PubTator Score 142.07

Knowledge Summary

Patent (52,062)


  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.036 0.005
chronic lymphocytic leukemia 1.408 0.001
cutaneous lupus erythematosus 1.200 0.009
osteosarcoma -3.653 0.000
non-small cell lung cancer -2.616 0.000
lung cancer -3.300 0.000
Breast cancer -2.100 0.039
interstitial cystitis 1.500 0.002
lung adenocarcinoma -2.200 0.000
lung carcinoma -1.900 0.000
mucosa-associated lymphoid tissue lympho... 1.849 0.012
ulcerative colitis 1.700 0.000


Accession P09769 D3DPL7 Q9UIQ3
Symbols SRC2



  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (8)

25972488 we provide evidence for involvement of HCK and FGR in FCRL4-mediated immunoregulation and for the functional importance of posttranslational modifications of the FCRL4 molecule.
24162774 HIV-1 gp120 downregulates the expression of feline Gardner-Rasheed sarcoma viral oncogene homolog (FGR) in human B cells
23896410 Data indicate that combined treatment using SFK (LYN, HCK, or FGR) and c-KIT inhibitor dasatinib dasatinib and chemotherapy provides a novel approach to increasing p53 activity and enhancing targeting of acute myeloid leukemia (AML) stem cells.
23867815 HIV-1 gp120 downregulates the expression of feline Gardner-Rasheed sarcoma viral oncogene homolog (FGR) in human B cells
21300758 Fgr plays a biologically significant role in ovarian cancer growth and might represent an important target
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17845055 Recruitment of the coactivator, SRC2, is coupled to cooperative DNA binding by the progesterone receptor.
11928806 Substitution of two relevant serines with glutamic acid residues in urokinase prevents urokinase activation of p55fgr needed for cell migration and adhesion.

AA Sequence

MEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT                                   491 - 529

Text Mined References (80)

PMID Year Title
25972488 2015 Involvement of the HCK and FGR src-family kinases in FCRL4-mediated immune regulation.
24860872 2014 Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
23896410 2013 The Src and c-Kit kinase inhibitor dasatinib enhances p53-mediated targeting of human acute myeloid leukemia stem cells by chemotherapeutic agents.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
21300758 2011 Functional roles of Src and Fgr in ovarian carcinoma.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19369195 2009 Large-scale proteomics analysis of the human kinome.