Property Summary

NCBI Gene PubMed Count 96
PubMed Score 711.10
PubTator Score 296.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.749 2.7e-02
active ulcerative colitis 2.547 3.8e-03
cystic fibrosis 4.154 2.2e-08
ductal carcinoma in situ 2.900 2.3e-02
interstitial cystitis -2.200 4.5e-02
intraductal papillary-mucinous carcinoma... 1.600 1.9e-02
intraductal papillary-mucinous neoplasm ... 2.800 1.1e-03
lung cancer -1.300 2.3e-03
lung carcinoma -3.900 3.9e-41
mucosa-associated lymphoid tissue lympho... 1.034 3.6e-02
nasopharyngeal carcinoma -2.300 1.3e-03
osteosarcoma -4.586 5.3e-07
ovarian cancer 1.400 7.3e-03
pancreatic cancer 2.100 2.1e-05
pancreatic ductal adenocarcinoma liver m... 5.171 9.3e-04
pulmonary arterial hypertension -2.300 4.5e-02
spina bifida -1.484 3.6e-02
tuberculosis -1.200 4.2e-02

 GO Function (1)

Gene RIF (78)

AA Sequence

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT      1 - 70
SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD     71 - 140
LSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTS    141 - 210
QKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAV    211 - 280
IVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL                               281 - 323
//

Text Mined References (98)

PMID Year Title