Property Summary

NCBI Gene PubMed Count 86
Grant Count 35
R01 Count 5
Funding $3,861,964.38
PubMed Score 684.31
PubTator Score 296.68

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (68)

PMID Text
26773504 Altogether, our data suggest that TROP2 plays an important role in promoting ADC and may represent a novel prognostic biomarker and therapeutic target for the disease.
26626643 TROP2 is epigenetically down-regulated and operates as a negative regulator of cell proliferation and migration in liver fluke-associated cholangiocarcinoma.
26617817 overexpression of TROP2 appears to be an independent predictor for poor clinical outcome in nasopharyngeal carcinoma
26600538 Lower GA733-2 expression in cancer tissues appeared to correlate with lymph node metastases (P < 0.05). GA733-1 gene expression was significantly higher in cancerous samples
26481593 TROP-2 is specifically expressed in papillary thyroid carcinoma.
26115884 The amino acid exchange resulting from 4461T[C does not appear to alter binding of HO-3, suggesting that treatment with catumaxomab can be offered to patients regardless of their TACSTD1-genotype.
26101915 Trop-2 is a novel target for ADC therapy because of its high expression by many solid cancers.
26059528 TROP2 protein is expressed at high levels in the colon cancer tissues.
25779928 These observations suggest that Trop2 serves an oncogenic role in LSCC and has potential as a therapeutic target
25550831 This study reveals that both EpCAM and Trop2 overexpression in pituitary adenomas correlate significantly with invasiveness and proliferation. Follow-up analysis shows that Trop2 is a predictive factor for recurrence/progression for PAs.
More...

AA Sequence

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT      1 - 70
SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD     71 - 140
LSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTS    141 - 210
QKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAV    211 - 280
IVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL                               281 - 323
//

Text Mined References (88)

PMID Year Title
26773504 2016 TROP2 overexpression promotes proliferation and invasion of lung adenocarcinoma cells.
26626643 Suppression of trophoblast cell surface antigen 2 enhances proliferation and migration in liver fluke-associated cholangiocarcinoma.
26617817 2015 Prognostic value of TROP2 in human nasopharyngeal carcinoma.
26600538 2015 Expression profile of the GA733 gene family in colorectal cancer: correlation with clinicopathological parameters.
26481593 2016 TROP-2 expression in papillary thyroid carcinoma: Potential Diagnostic Utility.
26115884 2015 Single nucleotide polymorphisms of the EpCAM-coding gene TACSTD1 in patients with ovarian cancer and their potential translational aspects.
26101915 2015 Trop-2 is a novel target for solid cancer therapy with sacituzumab govitecan (IMMU-132), an antibody-drug conjugate (ADC).
26059528 2015 Clinical investigation of TROP-2 as an independent biomarker and potential therapeutic target in colon cancer.
25779928 2015 Trop2 inhibition suppresses the proliferation and invasion of laryngeal carcinoma cells via the extracellular signal-regulated kinase/mitogen-activated protein kinase pathway.
25550831 2014 Overexpression of EpCAM and Trop2 in pituitary adenomas.
More...