Property Summary

NCBI Gene PubMed Count 74
Grant Count 25
R01 Count 11
Funding $4,466,727.93
PubMed Score 221.57
PubTator Score 107.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 2.800 0.000
osteosarcoma -1.616 0.005
lung cancer -1.700 0.001
interstitial cystitis 1.400 0.007
lung carcinoma -1.900 0.000
psoriasis 1.200 0.000

Gene RIF (99)

PMID Text
26109064 The docking site for CD3 subunits on the T Cell receptor beta chain has been identified by solution NMR.
25920998 The study identifies an important role of the CD3gamma dileucine motif in T-cell development most probably mediated by its fine-tuning of pre-TCR and TCR expression, down-regulation and signaling.
25760691 HER2/CD3 BsAb efficiently inhibited the growth of breast cancer tissue by activating and inducing the proliferation of tumor tissue infiltrating lymphocytes.
25505066 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
25467409 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
25467409 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
25113399 Low cord blood Foxp3/CD3gamma mRNA ratios are highly predictive for early allergy development.
24966976 Case Report: T-cell lymphoblastic leukemia/lymphoma with t(7;14)(p15;q32) [TCRgamma-TCL1A translocation] confirmed by FISH.
24910257 The results suggest that CD3G should be studied as a candidate gene for autoimmunity and that CD3gamma deficiency should be considered among other primary immunodeficiencies with predominantly autoimmune manifestations.
24794251 Data indicate that the high CD68/CD3 ratio identifies a bad prognosis group among muscle-invasive urothelial carcinoma (UC). cases.
More...

AA Sequence

MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKK      1 - 70
KWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQD     71 - 140
GVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN                                141 - 182
//

Text Mined References (77)

PMID Year Title
26109064 2015 Identification of the Docking Site for CD3 on the T Cell Receptor ? Chain by Solution NMR.
25920998 2015 Fine-tuning of T-cell development by the CD3? di-leucine-based TCR-sorting motif.
25760691 2015 Fully human HER2/cluster of differentiation 3 bispecific antibody triggers potent and specific cytotoxicity of T lymphocytes against breast cancer.
25113399 2015 Low cord blood Foxp3/CD3? mRNA ratios: a marker of increased risk for allergy development.
24966976 2014 T-cell lymphoblastic leukemia/lymphoma with t(7;14)(p15;q32) [TCR?-TCL1A translocation]: a case report and a review of the literature.
24910257 2014 CD3G gene defects in familial autoimmune thyroiditis.
24794251 2014 Infiltration of CD3? and CD68? cells in bladder cancer is subtype specific and affects the outcome of patients with muscle-invasive tumors.
23590417 2013 Variable presentation of primary immune deficiency: two cases with CD3 gamma deficiency presenting with only autoimmunity.
23348211 2013 TCR-? expression in primary cutaneous T-cell lymphomas.
23336327 2013 Human CD3?, but not CD3?, haploinsufficiency differentially impairs ?? versus ?? surface TCR expression.
More...