Property Summary

NCBI Gene PubMed Count 32
PubMed Score 1164.69
PubTator Score 966.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.400 1.8e-03
atypical teratoid/rhabdoid tumor -1.100 1.7e-03
cutaneous lupus erythematosus 1.500 3.4e-03

Protein-protein Interaction (1)

Gene RIF (19)

AA Sequence

MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTR      1 - 70
LSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR                        71 - 121
//

Text Mined References (32)

PMID Year Title