Property Summary

NCBI Gene PubMed Count 32
Grant Count 199
R01 Count 118
Funding $22,892,743.35
PubMed Score 1165.75
PubTator Score 966.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 0.003
adult high grade glioma -1.400 0.002
atypical teratoid/rhabdoid tumor -1.100 0.002

Synonym

Accession P09683
Symbols

Gene

SCT

Gene RIF (19)

PMID Text
23233532 CD36 is a major mediator of FA-induced release of CCK and secretin. These peptides contribute to the role of CD36 in fat absorption and to its pleiotropic metabolic effects.
23064014 a lineage of mature enteroendocrine cells have the ability to coexpress members of a group of functionally related peptides: CCK, secretin, GIP, GLP-1, PYY, and neurotensin
22964305 Data suggest that the interaction between secretin peptide residue H1 and secretin receptor residue W274 is most compatible with a hydrophobic interaction.
21851058 binding and activity of a series of 11 truncated and lactam-constrained secretin(5-27) analogues at the prototypic member of this family, the secretin receptor
21597914 Secretin effect on increase in transcription of the tyrosine hydroxylase (Th) gene and modulate catecholamine secretion, was tested.
20398908 Observational study of gene-disease association. (HuGE Navigator)
19904746 secretin significantly inhibited the tumor size and more than doubled tumor latency, which was associated with a decrease in proliferating cell nuclear antigen and an increase in cleaved-caspase 3 expression levels
19372104 Bile acids inhibit duodenal secretin expression via orphan nuclear receptor small heterodimer partner (SHP).
19239625 secretin acts through stimulation of presynaptic cholinergic neurons in a vagally mediated pathway.
18566919 These results collectively suggest that variable of tandem repeats could potentially be a functional regulator to control the expression of the human secretin gene in different individuals.
More...

AA Sequence

MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTR      1 - 70
LSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR                        71 - 121
//

Text Mined References (32)

PMID Year Title
25332973 2013 The physiological roles of secretin and its receptor.
23233532 2013 CD36-dependent signaling mediates fatty acid-induced gut release of secretin and cholecystokinin.
23064014 2012 A major lineage of enteroendocrine cells coexpress CCK, secretin, GIP, GLP-1, PYY, and neurotensin but not somatostatin.
22964305 2012 Mapping spatial approximations between the amino terminus of secretin and each of the extracellular loops of its receptor using cysteine trapping.
21851058 2011 Lactam constraints provide insights into the receptor-bound conformation of secretin and stabilize a receptor antagonist.
21597914 2011 Catecholamine biosynthesis and secretion: physiological and pharmacological effects of secretin.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
19904746 2010 Secretin inhibits cholangiocarcinoma growth via dysregulation of the cAMP-dependent signaling mechanisms of secretin receptor.
19372104 2009 Bile acids inhibit duodenal secretin expression via orphan nuclear receptor small heterodimer partner (SHP).
19239625 2009 Secretin-induced gastric relaxation is mediated by vasoactive intestinal polypeptide and prostaglandin pathways.
More...