Property Summary

NCBI Gene PubMed Count 71
Grant Count 94
R01 Count 62
Funding $6,154,892.67
PubMed Score 717.05
PubTator Score 839.15

Knowledge Summary

Patent

No data available

Synonym

Accession P09681 Q4VB42 Q6NTD3 GIP
Symbols

Gene

GIP

PANTHER Protein Class (2)

PDB

2QKH   1T5Q   2B4N   2L70   2L71   2OBU  

 GO Function (1)

 MGI Term (1)

Gene RIF (58)

PMID Text
26895276 Excess androgen activity might be a factor contributing to alter secretion of incretins in lean polycystic ovary syndrome (PCOS) women. However it could not be ruled out that it is also possible that increased GIP levels might induce hyperandrogenemia in PCOS.
26434625 Our results might indicate an altered DPP4-incretin system and altered immunoregulation including a potentially dysfunctional GLP1(9)(-)(36) signaling in T1DM.
26395740 Fasting GIP concentrations are higher in individuals with a history of cardiovascular disease (myocardial infarction, stroke) when compared with control subjects.
26221611 Data suggest that high levels of blood glucose or AGEs (advanced glycation end products), as seen in hyperglycemia, reduce secretion of insulin by pancreatic beta cells via antagonism of GIP (gastric inhibitory polypeptide)/GIP receptor signaling.
25852025 Data confirm that postprandial plasma levels of glucose-dependent insulinotropic polypeptide (GIP) and insulin (INS) are responsive to glycemic index of foods consumed; glycemic index of breakfast cereals regulate plasma postprandial GIP and INS.
25324507 These novel results support the notion that the GIP-GIPR axis plays a role in the etiology of central obesity in humans
25288806 phosphatidylinositol 3-kinase gamma has a role in insulin secretion induced by glucose-dependent insulinotropic polypeptide
25132122 Data suggest that postprandial blood levels of both GIP and insulin can be regulated by diet; here, inclusion of nopal/Opuntia/cactus (a functional food in traditional Mexican medicine) in breakfast reduces postprandial levels of GIP and insulin.
25029417 irisin and GIP might contribute to the development of polycystic ovary syndrome and may also represent novel polycystic ovary syndrome biomarkers
24525020 Dietary fructose elicits GLP-1 secretion without simultaneous release of glucagonotropic GIP.
More...

AA Sequence

MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQ      1 - 70
QDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLAC     71 - 140
LLDQTNLCRLRSR                                                             141 - 153
//

Text Mined References (71)

PMID Year Title
26895276 2016 Basic and Meal Stimulated Plasma GIP Levels are Higher in Lean PCOS Women with FAI over 5.
26434625 2015 Altered crosstalk in the dipeptidyl peptidase-4-incretin-immune system in type 1 diabetes: A hypothesis generating pilot study.
26395740 2016 Glucose-Dependent Insulinotropic Polypeptide Stimulates Osteopontin Expression in the Vasculature via Endothelin-1 and CREB.
26221611 2015 Effects of High Glucose Levels and Glycated Serum on GIP Responsiveness in the Pancreatic Beta Cell Line HIT-T15.
25852025 2015 Plasma glucose kinetics and response of insulin and GIP following a cereal breakfast in female subjects: effect of starch digestibility.
25416956 2014 A proteome-scale map of the human interactome network.
25324507 2014 Common variants of GIP are associated with visceral fat accumulation in Japanese adults.
25288806 2014 Insulin secretion induced by glucose-dependent insulinotropic polypeptide requires phosphatidylinositol 3-kinase ? in rodent and human ?-cells.
25132122 2014 The effect of nopal (Opuntia ficus indica) on postprandial blood glucose, incretins, and antioxidant activity in Mexican patients with type 2 diabetes after consumption of two different composition breakfasts.
25029417 2014 Circulating irisin and glucose-dependent insulinotropic peptide are associated with the development of polycystic ovary syndrome.
More...