Property Summary

Ligand Count 1
NCBI Gene PubMed Count 78
PubMed Score 737.74
PubTator Score 839.15

Knowledge Summary

Patent

No data available

 GO Function (1)

 MGI Phenotype (1)

Gene RIF (64)

AA Sequence

MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQ      1 - 70
QDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLAC     71 - 140
LLDQTNLCRLRSR                                                             141 - 153
//

Text Mined References (78)

PMID Year Title