Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.39
PubTator Score 9.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.071 0.026
Multiple myeloma 1.349 0.002
lung cancer 1.500 0.001
breast carcinoma 1.900 0.000
Breast cancer 3.200 0.026

Synonym

Accession P09669 B2R4D7
Symbols

Gene

Gene RIF (6)

PMID Text
25203353 Within the first 3h of infection with influenza virus, significant down-regulation of hsa-miRNA-4276 is followed by a 2-fold increase in cytochrome c oxidase VIc mRNA was found to occur in human alveolar and bronchial epithelial cells.
22860893 Data indicate that recombinant (r)IL-24 stimulated the mitochondrial apoptotic pathway genes Bax, Bid, Casp8, COX6C, COX7B after 36 h.
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
20877624 Observational study of gene-disease association. (HuGE Navigator)
19843159 Data found that subunits Cox6a, Cox6b and Cox7a assembled into pre-existing complex IV, while Cox4-1 and Cox6c subunits assembled into subcomplexes that may represent rate-limiting intermediates.
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGI      1 - 70
FQSVK                                                                      71 - 75
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25203353 2014 Lung epithelial cells resist influenza A infection by inducing the expression of cytochrome c oxidase VIc which is modulated by miRNA 4276.
22860893 2013 Interleukin-24 mediates apoptosis in human B-cells through early activation of cell cycle arrest followed by late induction of the mitochondrial apoptosis pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19843159 2009 Assembly of nuclear DNA-encoded subunits into mitochondrial complex IV, and their preferential integration into supercomplex forms in patient mitochondria.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17516841 2007 Mid-region parathyroid hormone-related protein (PTHrP) and gene expression of MDA-MB231 breast cancer cells.
More...