Property Summary

Ligand Count 15
NCBI Gene PubMed Count 66
PubMed Score 221.97
PubTator Score 101.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis 1.040 4.4e-03
adrenocortical carcinoma -1.133 1.1e-02
esophageal adenocarcinoma 1.200 2.4e-02
group 4 medulloblastoma -1.900 2.7e-06
intraductal papillary-mucinous neoplasm ... 1.200 1.8e-02
invasive ductal carcinoma 1.091 1.6e-02
lung adenocarcinoma -1.200 5.5e-03
lung cancer -3.600 9.7e-06
lung carcinoma -3.900 2.0e-35
medulloblastoma, large-cell -1.900 7.3e-05
mucosa-associated lymphoid tissue lympho... 1.774 3.7e-02
nephrosclerosis -1.462 1.2e-02
non-small cell lung cancer -1.680 9.9e-16
ovarian cancer -1.800 2.9e-05
posterior fossa group A ependymoma 1.400 1.5e-05
subependymal giant cell astrocytoma 3.662 2.5e-03
tuberculosis 1.200 1.5e-07

Gene RIF (33)

AA Sequence

MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNN      1 - 70
GNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGS     71 - 140
CWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGK    141 - 210
DGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVN    211 - 280
HAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV                   281 - 335
//

Text Mined References (73)

PMID Year Title