Property Summary

NCBI Gene PubMed Count 65
Grant Count 6
R01 Count 6
Funding $418,322.8
PubMed Score 217.55
PubTator Score 101.01

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P09668 B2RBK0 Q96NY6 Q9BUM7
Symbols ACC4
ACC5
CPSB
ACC-4
ACC-5

Gene

PANTHER Protein Class (3)

PDB

1BZN  

Gene RIF (32)

PMID Text
26960148 p41 fragment is also shown to reduce the secretion of interleukin-12 (IL-12/p70) during the subsequent maturation of treated dendritic cells.
26429317 Especially, rs3825932 in CTSH has integrative functional evidence supporting the association with type 1 diabetes mellitus.
26245339 In conclusion, CTSH/rs3825932 and ERBB3/rs2292239 SNPs were associated with reduced risk of progression to proliferative diabetic retinopathy and two-step progression of diabetic retinopathy on the ETDRS scale accordingly.
25525168 mutation in LRPAP1 is associated with high myopia. Further studies are expected to evaluate the pathogenicity of the variants in CTSH, LEPREL1, ZNF644, SLC39A5, and SCO2.
24982147 The data provide strong evidence that CTSH is an important regulator of beta-cell function during progression of T1D
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of cathepsin H (CTSH) expression by HIV-1 Vpr in Vpr transduced macrophages
23483898 Quantification of immunohistochemistry showed that there is no difference in the global expression of CTSD, CTSH and CTSK between asthmatics and non-asthmatics.
23204516 CtsH-mediated processing of talin might promote cancer cell progression by affecting integrin alphaVbeta3 activation and adhesion strength
22704610 The processing of procathepsin H is an autocatalytic, multistep process proceeding from an inactive 41kDa pro-form, through a 30kDa intermediate form, to the 28kDa mature form.
21217776 CTSH overexpression in a subset hepatoma may be thyroid hormone receptor dependent and suggests that this overexpression has an important role in hepatoma progression.
More...

AA Sequence

MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNN      1 - 70
GNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGS     71 - 140
CWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGK    141 - 210
DGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVN    211 - 280
HAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV                   281 - 335
//

Text Mined References (72)

PMID Year Title
26960148 2016 Exogenous Thyropin from p41 Invariant Chain Diminishes Cysteine Protease Activity and Affects IL-12 Secretion during Maturation of Human Dendritic Cells.
26429317 2015 Functional relevance for type 1 diabetes mellitus-associated genetic variants by using integrative analyses.
26245339 2015 Polymorphisms in the CTSH gene may influence the progression of diabetic retinopathy: a candidate-gene study in the Danish Cohort of Pediatric Diabetes 1987 (DCPD1987).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25525168 2014 Detection of mutations in LRPAP1, CTSH, LEPREL1, ZNF644, SLC39A5, and SCO2 in 298 families with early-onset high myopia by exome sequencing.
24982147 2014 CTSH regulates ?-cell function and disease progression in newly diagnosed type 1 diabetes patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23483898 2013 The expression and activity of cathepsins D, H and K in asthmatic airways.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...