Property Summary

NCBI Gene PubMed Count 24
Grant Count 6
R01 Count 6
Funding $342,111.5
PubMed Score 15.29
PubTator Score 6.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Pasteurellosis 12 3.924 2.0

Expression

Gene RIF (6)

PMID Text
25496916 Small nuclear ribonucleoprotein polypeptide A' (SNRPA1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24866816 Data suggest that protein-protein interactions localize U2A' (SNRPA1) to the U2 snRNP (U2 small nuclear ribonucleoprotein) and exclude it from the U1 snRNP, rather than to enhance U2 snRNA (U2 small nuclear RNA; RNU2-1) binding of U2B'' (SNRPB2).
18854154 Knockdown of small nuclear ribonucleoprotein polypeptide A' (SNRPA1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
11780068 Small nuclear ribonucleoprotein polypeptide A' (SNRPA1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
10811961 PMID:10811961 pertains mostly to salmon, but has some reference to human.
8331728 Small nuclear ribonucleoprotein polypeptide A' (SNRPA1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS

AA Sequence

MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLL      1 - 70
VNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVP     71 - 140
QVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIAN    141 - 210
ASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS                             211 - 255
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24866816 2014 Binding affinity and cooperativity control U2B?/snRNA/U2A' RNP formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...