Property Summary

NCBI Gene PubMed Count 24
PubMed Score 17.02
PubTator Score 6.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Pierson syndrome 13 4.483 2.2
Pasteurellosis 12 3.731 1.9

Expression

 GWAS Trait (1)

Gene RIF (6)

AA Sequence

MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLL      1 - 70
VNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVP     71 - 140
QVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIAN    141 - 210
ASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS                             211 - 255
//

Text Mined References (34)

PMID Year Title