Property Summary

Ligand Count 1
NCBI Gene PubMed Count 177
PubMed Score 376.53
PubTator Score 266.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.194 4.7e-06
astrocytic glioma 2.100 4.8e-03
atypical teratoid/rhabdoid tumor 1.100 1.5e-04
colon cancer 1.200 6.1e-04
dermatomyositis 1.100 2.0e-04
ependymoma 2.700 9.7e-03
glioblastoma 1.100 1.7e-02
group 3 medulloblastoma 1.400 3.8e-03
intraductal papillary-mucinous carcinoma... 1.300 2.9e-03
intraductal papillary-mucinous neoplasm ... 1.300 9.8e-03
lung cancer 1.100 8.4e-04
medulloblastoma, large-cell 1.100 6.9e-04
Multiple myeloma 1.785 1.1e-03
nasopharyngeal carcinoma 1.100 9.3e-04
oligodendroglioma 2.000 4.8e-03
osteosarcoma -1.568 1.5e-04
ovarian cancer -1.100 1.1e-04
pancreatic ductal adenocarcinoma liver m... 1.058 4.6e-02
Pick disease -1.600 2.5e-05
primitive neuroectodermal tumor 1.100 2.2e-03
progressive supranuclear palsy -1.400 1.9e-02
psoriasis -2.000 6.2e-05
Waldenstrons macroglobulinemia 1.466 4.7e-04

Gene RIF (122)

AA Sequence

MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDA      1 - 70
AMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDR     71 - 140
GSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGF    141 - 210
GGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSG    211 - 280
YGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAK    281 - 350
PRNQGGYGGSSSSSSYGSGRRF                                                    351 - 372
//

Text Mined References (195)

PMID Year Title