Property Summary

NCBI Gene PubMed Count 161
Grant Count 124
R01 Count 102
Funding $13,592,971.36
PubMed Score 353.35
PubTator Score 266.09

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P09651 A8K4Z8 Q3MIB7 Q6PJZ7 hnRNP A1
Symbols UP 1
ALS19
ALS20
HNRPA1
IBMPFD3
HNRPA1L3
hnRNP A1
hnRNP-A1

Gene

PDB

2H4M   1HA1   1L3K   1PGZ   1PO6   1U1K   1U1L   1U1M   1U1N   1U1O   1U1P   1U1Q   1U1R   1UP1   2LYV   2UP1   4YOE  

Gene RIF (114)

PMID Text
27168114 The sST2-5'UTR contains an IRES element, which is activated by a MEK/ERK-dependent increase in cytoplasmic localization of hnRNP A1 in response to FGF2, enhancing the translation of sST2.
26869449 hnRNP A1 is implicated in the free fatty acid-induced expression of SREBP-1a and of its target genes as well as in the lipid accumulation in hepatocytes.
26825578 The CCAT1/miR-490/hnRNPA1 axis promotes gastric cancer migration, and it may have a possible diagnostic and therapeutic potential in gastric cancer.
26791953 We demonstrate that an hnRNPA1 and CBX5 bi-directional core promoter fragment does not comprise intrinsic capacity for specific CBX5 down-regulation in metastatic cells
26674223 Data show that heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) unfolds the HRAS protein i-motif.
26607354 analysis of HIV-1 intron splicing silencer and its interactions with the UP1 domain of hnRNPA1
26581508 HNRNPA1 might play an important role in lung adenocarcinoma cells.
26518267 In neuroblastoma cells, hnRNP A1 directly interacts with Drp1 mRNA at its 3'UTR region, and enhances translation potential without affecting mRNA stability.
26494299 MiR-26a and mir-584 inhibit the binding of hnRNP A1-CDK6 mRNA and induce colorectal cancer cell apoptosis.
26412307 The disordered regions of key RNP granule components and the full-length granule protein hnRNPA1 can phase separate in vitro, producing dynamic liquid droplets.
More...

AA Sequence

MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDA      1 - 70
AMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDR     71 - 140
GSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGF    141 - 210
GGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSG    211 - 280
YGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAK    281 - 350
PRNQGGYGGSSSSSSYGSGRRF                                                    351 - 372
//

Text Mined References (178)

PMID Year Title
27694260 2016 Whole-exome sequencing identifies a missense mutation in hnRNPA1 in a family with flail arm ALS.
27168114 2016 sST2 translation is regulated by FGF2 via an hnRNP A1-mediated IRES-dependent mechanism.
26869449 2016 Lipid accumulation stimulates the cap-independent translation of SREBP-1a mRNA by promoting hnRNP A1 binding to its 5'-UTR in a cellular model of hepatic steatosis.
26825578 2016 The long noncoding RNA colon cancer-associated transcript-1/miR-490 axis regulates gastric cancer cell migration by targeting hnRNPA1.
26791953 2016 Regulatory dissection of the CBX5 and hnRNPA1 bi-directional promoter in human breast cancer cells reveals novel transcript variants differentially associated with HP1? down-regulation in metastatic cells.
26674223 2015 GC-elements controlling HRAS transcription form i-motif structures unfolded by heterogeneous ribonucleoprotein particle A1.
26607354 2016 Solution Structure of the HIV-1 Intron Splicing Silencer and Its Interactions with the UP1 Domain of Heterogeneous Nuclear Ribonucleoprotein (hnRNP) A1.
26581508 2016 Knockdown of HNRNPA1 inhibits lung adenocarcinoma cell proliferation through cell cycle arrest at G0/G1 phase.
26518267 2015 Heterogeneous nuclear ribonucleoprotein A1 post-transcriptionally regulates Drp1 expression in neuroblastoma cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
More...