Property Summary

NCBI Gene PubMed Count 27
Grant Count 22
R01 Count 11
Funding $1,549,509.36
PubMed Score 63.02
PubTator Score 38.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26310814 HOXC6 has a role in all prostate cancer stages, particularly in prostate cancer cell proliferation.
26046583 Data demonstrate significant downregulation of HOXC6 in serous ovarian cancer and low protein level is associated with high-grade tumors.
25725483 Our studies demonstrate that HOXC6, which is a critical player in mammary gland development, is upregulated in multiple cases of breast cancer, and is transcriptionally regulated by E2 and BPA, in vitro and in vivo.
24525058 HOXC6 can be used as a prognostic marker in esophageal squamous cell carcinoma
23581417 Hoxc6 might contribute to the progression of gastric carcinogenesis and may be a significant predictor of poor survival in patients with gastric cancer after curative operations.
22907429 HOXC6 expression is an important mechanism of chemotherapeutic drug resistance via its regulation of MDR-1
22896703 HOXC6 is an important mechanism of the anti-apoptotic pathway via regulation of Bcl-2 expression.
21683083 These studies demonstrated that HOXC6 is an estrogen-responsive gene, and that histone methylases MLL2 and MLL3, in coordination with ERalpha and ERbeta, transcriptionally regulate HOXC6 in an estrogen-dependent manner.
19236766 Human cytomegalovirus downregulates while all-trans retinoic acid upregulates expression of hoxc4 and hoxc6 in lymphocytic progenitor cells.
17488478 HOXC6 increases transcription of S100beta gene in BrdU-induced in vitro differentiation of GOTO neuroblastoma cells into Schwann cells.
More...

AA Sequence

MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPY      1 - 70
DYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGAD     71 - 140
RRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGG    141 - 210
GGATADSLGGKEEKREETEEEKQKE                                                 211 - 235
//

Text Mined References (28)

PMID Year Title
26310814 2015 The role of HOXC6 in prostate cancer development.
26046583 2015 Downregulation of HOXC6 in Serous Ovarian Cancer.
25725483 2015 Bisphenol-A induces expression of HOXC6, an estrogen-regulated homeobox-containing gene associated with breast cancer.
24525058 2014 The survival predictive significance of HOXC6 and HOXC8 in esophageal squamous cell carcinoma.
23581417 2013 Upregulated Hoxc6 expression is associated with poor survival in gastric cancer patients.
22907429 2013 Transcriptional regulation of MDR-1 by HOXC6 in multidrug-resistant cells.
22896703 2012 HOXC6 is deregulated in human head and neck squamous cell carcinoma and modulates Bcl-2 expression.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21683083 2011 HOXC6 Is transcriptionally regulated via coordination of MLL histone methylase and estrogen receptor in an estrogen environment.
19236766 2009 [Effect of human cytomegalovirus infection on the expression of hoxc4 and hoxc6 genes in the proliferation of lymphocytic progenitor cells].
More...