Property Summary

NCBI Gene PubMed Count 31
PubMed Score 68.90
PubTator Score 38.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical adenoma -1.190 3.9e-02
adult high grade glioma 1.900 1.3e-04
Astrocytoma, Pilocytic 1.500 4.8e-02
atypical teratoid / rhabdoid tumor 2.300 2.7e-02
colon cancer 2.300 2.1e-03
cutaneous lupus erythematosus -2.100 8.5e-03
cystic fibrosis -2.422 3.1e-06
dermatomyositis 1.400 1.8e-03
glioblastoma 2.500 1.4e-04
group 3 medulloblastoma 2.500 1.9e-02
intraductal papillary-mucinous carcinoma... 5.200 5.8e-06
intraductal papillary-mucinous neoplasm ... 5.200 3.0e-06
juvenile dermatomyositis 1.134 1.5e-09
malignant mesothelioma -1.100 1.7e-05
medulloblastoma, large-cell 3.200 5.3e-04
nasopharyngeal carcinoma 2.300 7.0e-05
non-small cell lung cancer 1.379 2.0e-07
osteosarcoma 2.562 5.6e-04
ovarian cancer -5.000 1.3e-14
pancreatic cancer 2.000 6.5e-05
primitive neuroectodermal tumor 3.100 3.7e-02
psoriasis -1.300 1.6e-06

Gene RIF (15)

AA Sequence

MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPY      1 - 70
DYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGAD     71 - 140
RRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGG    141 - 210
GGATADSLGGKEEKREETEEEKQKE                                                 211 - 235
//

Text Mined References (32)

PMID Year Title