Property Summary

NCBI Gene PubMed Count 75
PubMed Score 103.99
PubTator Score 79.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.500 5.0e-05
Astrocytoma, Pilocytic 1.500 2.3e-03
atypical teratoid / rhabdoid tumor 1.200 6.1e-03
Barrett's esophagus 1.300 3.7e-02
Breast cancer 1.800 2.2e-05
cutaneous lupus erythematosus -2.100 1.4e-02
cystic fibrosis -1.543 6.5e-04
esophageal adenocarcinoma 2.100 1.8e-02
gastric carcinoma 3.300 5.2e-03
glioblastoma 1.300 1.5e-03
interstitial cystitis -1.100 2.6e-03
intraductal papillary-mucinous carcinoma... 2.400 2.0e-02
lung adenocarcinoma 1.100 9.8e-07
medulloblastoma, large-cell 1.800 6.8e-03
non primary Sjogren syndrome sicca -1.100 2.7e-02
non-small cell lung cancer 1.583 2.0e-10
osteosarcoma 1.223 4.3e-04
ovarian cancer 1.200 1.2e-02
pancreatic cancer 1.800 9.7e-06
pancreatic ductal adenocarcinoma liver m... 1.062 1.8e-02
primitive neuroectodermal tumor 2.400 4.0e-02

Gene RIF (42)

AA Sequence

MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSA      1 - 70
AGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRG     71 - 140
RQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAE    141 - 210
AEEEEEE                                                                   211 - 217
//

Text Mined References (78)

PMID Year Title