Property Summary

NCBI Gene PubMed Count 67
Grant Count 16
R01 Count 14
Funding $2,488,462.39
PubMed Score 96.37
PubTator Score 79.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

PMID Text
26902420 Results point out the complex interplay between the DSB DNA repair activity and the homeoproteins HoxB7 and Cdx2 in colon cancer cells.
26403398 HoxB7 is associated with tumor metastasis in patients with lung adenocarcinoma and HoxB7 may be implicated in promoting the development of lung adenocarcinoma through activation of the TGF-beta/SMAD3 signaling.
26180042 HOXB7 Is an ERalpha Cofactor in the Activation of HER2 and Multiple ER Target Genes Leading to Endocrine Resistance
26135503 HOXB7 protein expression level is downregulated following siRNA transfection and downregulation of HOXB7 gene expression effectively inhibits MCF-7 cell proliferation.
26076456 HOXB7 could promote cancer cell proliferation and might be an independent prognostic factor for patients with esophageal squamous cell carcinoma.
26014856 Study reports >1,500 chromatin binding sites in the genome of a breast cancer cell line overexpressing HOXB7 and identifies some potential direct targets that are located nearby.
25565354 Myelomeningocele is significantly associated with HOXB7 hypomethylation.
25542862 our results suggest that HOXB7 promotes tumor progression in a cell-autonomous and non-cell-autonomous manner through activation of the TGFbeta signaling pathway.
25428821 Results demonstrate HOXB7 as a master factor driving progenitors behavior lifetime, providing a better understanding of bone senescence and leading to an optimization of MSC performance.
24853421 Results suggest that p53-regulated TUG1 is a growth regulator, which acts in part through control of HOXB7 in non-small cell lung cancer.
More...

AA Sequence

MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSA      1 - 70
AGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRG     71 - 140
RQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAE    141 - 210
AEEEEEE                                                                   211 - 217
//

Text Mined References (70)

PMID Year Title
26902420 2016 Distinct mechanisms for opposite functions of homeoproteins Cdx2 and HoxB7 in double-strand break DNA repair in colon cancer cells.
26403398 HoxB7 PROMOTES GROWTH AND METASTASIS OF LUNG ADENOCARCINOMA CELLS THROUGH REGULATION OF THE TGF-?/SMAD3 SIGNALING.
26180042 2015 HOXB7 Is an ER? Cofactor in the Activation of HER2 and Multiple ER Target Genes Leading to Endocrine Resistance.
26135503 2015 HOXB7-S3 inhibits the proliferation and invasion of MCF-7 human breast cancer cells.
26076456 2015 Deregulated HOXB7 Expression Predicts Poor Prognosis of Patients with Esophageal Squamous Cell Carcinoma and Regulates Cancer Cell Proliferation In Vitro and In Vivo.
26014856 2015 Identification of several potential chromatin binding sites of HOXB7 and its downstream target genes in breast cancer.
25565354 2015 DNA methylation analysis of Homeobox genes implicates HOXB7 hypomethylation as risk factor for neural tube defects.
25542862 2015 HOXB7 promotes malignant progression by activating the TGF? signaling pathway.
25428821 2015 Mesenchymal progenitors aging highlights a miR-196 switch targeting HOXB7 as master regulator of proliferation and osteogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
More...