Property Summary

NCBI Gene PubMed Count 67
PubMed Score 96.37
PubTator Score 79.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.95660770985953E-10
lung adenocarcinoma 2714 9.77391933218201E-7
pancreatic cancer 2300 9.6878811045038E-6
Breast cancer 3099 2.17613857981124E-5
osteosarcoma 7933 4.34998520301216E-4
ovarian cancer 8492 6.39222814321645E-4
cystic fibrosis 1670 6.47656291066294E-4
pediatric high grade glioma 2712 0.00113491317971408
pilocytic astrocytoma 3086 0.00252633252028893
interstitial cystitis 2299 0.00261699111621134
gastric carcinoma 832 0.00517349063969526
atypical teratoid / rhabdoid tumor 4369 0.00611831647838014
medulloblastoma, large-cell 6234 0.00675077939202925
cutaneous lupus erythematosus 1056 0.00949446104662648
glioblastoma 5572 0.0100406858535468
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0175046285847996
esophageal adenocarcinoma 737 0.0176010007179145
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0201208185704035
non primary Sjogren syndrome sicca 840 0.0274767898440847
Barrett's esophagus 185 0.0372811310844604
primitive neuroectodermal tumor 3031 0.0401271034241257
Disease Target Count Z-score Confidence
Hydronephrosis 19 3.602 1.8
Cancer 2346 3.527 1.8

Expression

Synonym

Accession P09629 A8K3N8 Q15957 Q53FN3 Q96BQ6
Symbols HOX2
HOX2C
HHO.C1
Hox-2.3

Gene

  Ortholog (10)

Gene RIF (34)

PMID Text
26902420 Results point out the complex interplay between the DSB DNA repair activity and the homeoproteins HoxB7 and Cdx2 in colon cancer cells.
26403398 HoxB7 is associated with tumor metastasis in patients with lung adenocarcinoma and HoxB7 may be implicated in promoting the development of lung adenocarcinoma through activation of the TGF-beta/SMAD3 signaling.
26180042 HOXB7 Is an ERalpha Cofactor in the Activation of HER2 and Multiple ER Target Genes Leading to Endocrine Resistance
26135503 HOXB7 protein expression level is downregulated following siRNA transfection and downregulation of HOXB7 gene expression effectively inhibits MCF-7 cell proliferation.
26076456 HOXB7 could promote cancer cell proliferation and might be an independent prognostic factor for patients with esophageal squamous cell carcinoma.
26014856 Study reports >1,500 chromatin binding sites in the genome of a breast cancer cell line overexpressing HOXB7 and identifies some potential direct targets that are located nearby.
25565354 Myelomeningocele is significantly associated with HOXB7 hypomethylation.
25542862 our results suggest that HOXB7 promotes tumor progression in a cell-autonomous and non-cell-autonomous manner through activation of the TGFbeta signaling pathway.
25428821 Results demonstrate HOXB7 as a master factor driving progenitors behavior lifetime, providing a better understanding of bone senescence and leading to an optimization of MSC performance.
24853421 Results suggest that p53-regulated TUG1 is a growth regulator, which acts in part through control of HOXB7 in non-small cell lung cancer.
More...

AA Sequence

MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSA      1 - 70
AGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRG     71 - 140
RQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAE    141 - 210
AEEEEEE                                                                   211 - 217
//

Text Mined References (70)

PMID Year Title
26902420 2016 Distinct mechanisms for opposite functions of homeoproteins Cdx2 and HoxB7 in double-strand break DNA repair in colon cancer cells.
26403398 HoxB7 PROMOTES GROWTH AND METASTASIS OF LUNG ADENOCARCINOMA CELLS THROUGH REGULATION OF THE TGF-?/SMAD3 SIGNALING.
26180042 2015 HOXB7 Is an ER? Cofactor in the Activation of HER2 and Multiple ER Target Genes Leading to Endocrine Resistance.
26135503 2015 HOXB7-S3 inhibits the proliferation and invasion of MCF-7 human breast cancer cells.
26076456 2015 Deregulated HOXB7 Expression Predicts Poor Prognosis of Patients with Esophageal Squamous Cell Carcinoma and Regulates Cancer Cell Proliferation In Vitro and In Vivo.
26014856 2015 Identification of several potential chromatin binding sites of HOXB7 and its downstream target genes in breast cancer.
25565354 2015 DNA methylation analysis of Homeobox genes implicates HOXB7 hypomethylation as risk factor for neural tube defects.
25542862 2015 HOXB7 promotes malignant progression by activating the TGF? signaling pathway.
25428821 2015 Mesenchymal progenitors aging highlights a miR-196 switch targeting HOXB7 as master regulator of proliferation and osteogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
More...