Property Summary

NCBI Gene PubMed Count 50
PubMed Score 373.13
PubTator Score 512.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.186 1.7e-04
Multiple myeloma 1.482 1.2e-03
ovarian cancer -1.200 5.8e-03
pancreatic ductal adenocarcinoma liver m... -1.947 2.5e-02

Gene RIF (25)

AA Sequence

MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCI      1 - 70
EKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLDKMMEQKSTAVKALTGGIAH     71 - 140
LFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLK    141 - 210
KVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTG    211 - 280
ATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNI    281 - 350
YAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK    351 - 420
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTL    421 - 490
SEAFREANLAASFGKSINF                                                       491 - 509
//

Text Mined References (67)

PMID Year Title