Property Summary

NCBI Gene PubMed Count 370
Grant Count 547
R01 Count 303
Funding $57,396,882.01
PubMed Score 653.85
PubTator Score 947.18

Knowledge Summary

Patent (175,967)

TINX Plot

  Disease Relevance (46)

Disease Z-score Confidence
Cancer 2,346 5.362 2.7
Eosinophilia 65 4.916 2.5
Infantile myofibromatosis 13 4.314 2.2
Basal ganglia calcification 17 4.276 2.1
Mastocytosis 27 3.772 1.9
Polycythemia Vera 24 3.28 1.6
Diarrhea 155 3.264 1.6
Exanthem 39 3.185 1.6
BASAL GANGLIA CALCIFICATION, IDIOPATHIC,... 1 
Basal Ganglia Diseases 12
Blastic phase chronic myeloid leukemia 58
Breast cancer 3,094
Calcinosis 62
Carcinoma 2,147 1.0
Carcinoma of thyroid 17
Chronic Myelocytic Leukemia Accelerated ... 59 
Chronic eosinophilic leukemia 11
Chronic phase chronic myeloid leukemia 45
Dermatofibrosarcoma protuberans 16
Fahr's syndrome (disorder) 4
Gastrointestinal stromal tumor 61
Hamman-Rich syndrome 35
Idiopathic hypereosinophilic syndrome 9
Leukemia, Myelomonocytic, Chronic 2
Liver Cirrhosis, Experimental 108
Liver cell carcinoma 15
MYELOPROLIFERATIVE DISORDER, CHRONIC, WI... 2 
Myelodysplastic/ Myeloproliferative Dise... 9 
Myeloid neoplasm with beta-type platelet... 1 
Neuropathic diabetic ulcer - foot 2
Pancreatic Neuroendocrine Tumor 45
Penttinen-Aula syndrome 1
Philadelphia Chromosome Positive Chronic... 45 
Philadelphia chromosome-positive acute l... 47 
Renal Cell Carcinoma 199
Sarcoma of soft tissue 11
Systemic mast cell disease 12
cystic fibrosis 1,665
gastric carcinoma 832
interstitial cystitis 2,299
invasive ductal carcinoma 2,950
malignant mesothelioma 3,162
non-small cell lung cancer 2,798
pancreatic cancer 2,300
primary pancreatic ductal adenocarcinoma 1,271
urothelial carcinoma 318

Expression

  Differential Expression (9)

Disease log2 FC p
urothelial carcinoma 1.100 0.030
malignant mesothelioma 2.500 0.000
cystic fibrosis -2.351 0.000
primary pancreatic ductal adenocarcinoma 1.627 0.004
interstitial cystitis 1.400 0.003
Breast cancer 1.200 0.000
gastric carcinoma 2.100 0.004
invasive ductal carcinoma -1.200 0.004
pancreatic cancer 1.500 0.002

Synonym

Accession P09619 B5A957 Q8N5L4 PDGF-R-beta
Symbols IMF1
KOGS
IBGC4
JTK12
PDGFR
PENTT
CD140B
PDGFR1
PDGFR-1

Gene

PDB

3MJG   1H9O   1GQ5   1LWP   1SHA   2L6W   2PLD   2PLE  

  TechDev Info (1)

Michael McManus Genetic interaction screen

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (230)

PMID Text
26881541 PDGFRB gene rearrangement is associated with transformation from atypical chronic myeloid leukemia to chronic myelomonocytic leukemia.
26787464 Data suggest that cross-talk between PDGFb-dependent beta-catenin activation and Wnt signaling increases pulmonary artery smooth muscle cell proliferation in idiopathic pulmonary arterial hypertension; proliferation is not increased in normal cells.
26662677 These molecular insights confirm that mutant PDGFRB is indeed the driver mutation in PDGFRB rearranged myeloid neoplasms, consistent with the robust treatment responses with imatinib.
26599395 loss-of-function mutations in PDGFB or PDGFRB cause Primary Familial Brain Calcification.
26569132 Results suggested that increased bFGF upregulates the expression of PDGFRbeta and may enhance PDGFRbeta-mediated pericyte functions after brain ischemia
26483058 The KIT and PDGFRB mutations were predicted to be pathogenic using in silico analysis, whereas the ERBB2 mutation was predicted to be benign.. the patient was treated with pazopanib and achieved a partial response that lasted for 7.5 months
26463591 Electron microscopy structure of PDGFRB [a full-length human platelet-derived growth factor receptor], in complex with its ligand PDGF-B.
26407747 Soluble platelet-derived growth factor receptor-beta is a biomarker of brain pericyte injury and blood-brain barrier dysfunction.
26403314 Data identify PDGFRbeta as the hub gene in both inflammatory (IBC) and non-inflammatory breast neoplasm (non-IBC) and SUMO1 and COL1A1 the respective key genes for IBC and non-IBC suggesting they might play important role in the pathogenesis of the neoplasm.
26279204 A Point Mutation in PDGFRB Causes Autosomal-Dominant Penttinen Syndrome.
More...

AA Sequence

MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPP      1 - 70
QEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLT     71 - 140
EITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQ    141 - 210
VSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPS    211 - 280
AELEDSGTYTCNVTESVNDHQDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLW    281 - 350
FKDNRTLGDSSAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL    351 - 420
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNVTYWEEEQEFE    421 - 490
VVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILALVVLTIISLIILIMLWQKKP    491 - 560
RYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMK    561 - 630
VAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTF    631 - 700
LQHHSDKRRPPSAELYSNALPVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSN    701 - 770
YMAPYDNYVPSAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV    771 - 840
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMN    841 - 910
EQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRS    911 - 980
DHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLN    981 - 1050
EVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAEAEDSFL                 1051 - 1106
//

Text Mined References (384)

PMID Year Title
26881541 Transformation from atypical chronic myeloid leukemia to chronic myelomonocytic leukemia as progression of myeloid neoplasm with platelet-derived growth factor ß rearrangement.
26787464 2016 PDGF-dependent ?-catenin activation is associated with abnormal pulmonary artery smooth muscle cell proliferation in pulmonary arterial hypertension.
26662677 2016 Targeted next generation sequencing of PDGFRB rearranged myeloid neoplasms with monocytosis.
26599395 2015 Functional Characterization of Germline Mutations in PDGFB and PDGFRB in Primary Familial Brain Calcification.
26569132 2016 Possible involvement of basic FGF in the upregulation of PDGFR? in pericytes after ischemic stroke.
26483058 2015 Next-Generation Sequencing and In Silico Analysis Facilitate Prolonged Response to Pazopanib in a Patient With Metastatic Urothelial Carcinoma of the Renal Pelvis.
26463591 2015 Structure of Full-Length Human PDGFR? Bound to Its Activating Ligand PDGF-B as Determined by Negative-Stain Electron Microscopy.
26407747 2015 Shedding of soluble platelet-derived growth factor receptor-? from human brain pericytes.
26403314 2016 Systematically identify key genes in inflammatory and non-inflammatory breast cancer.
26315405 2015 XBP 1-Deficiency Abrogates Neointimal Lesion of Injured Vessels Via Cross Talk With the PDGF Signaling.
More...