Property Summary

NCBI Gene PubMed Count 198
Grant Count 646
R01 Count 460
Funding $62,908,667.67
PubMed Score 1339.46
PubTator Score 1302.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -2.700 0.000
psoriasis -1.200 0.003
glioblastoma 1.500 0.000
medulloblastoma, large-cell 1.300 0.000
lung cancer -4.300 0.000
adult high grade glioma 1.300 0.001
group 4 medulloblastoma -1.200 0.000
pilocytic astrocytoma 1.100 0.001
COPD -1.200 0.034
lung carcinoma -1.500 0.000

Synonym

Accession P09603 A8K6J5 Q13130 Q14086 Q14806 Q5VVF3 Q5VVF4 Q9UQR8 CSF-1
Symbols MCSF
CSF-1

Gene

PANTHER Protein Class (2)

PDB

1HMC   3UEZ   3UF2   4ADF   4FA8   4WRL   4WRM  

Gene RIF (153)

PMID Text
26686751 This can be achieved by either blocking the EGF or CSF-1 receptors or supressing the EGF or CSF-1 signal.
26642091 peripheral nerve injury induced de novo expression of colony-stimulating factor 1 (CSF1) in injured sensory neurons. CSF1 was transported to the spinal cord, where it targeted the microglial CSF1 receptor (CSF1R).
26376111 In patients with CLE, 100 and 150 mg PD-0360324 (monoclonal antibody against MCSF) every 2 weeks for 3 months suppressed a subset of circulating monocytes.
26359491 By identifying the M-CSFM residues critical for M-CSF-c-FMS interactions, we have laid down the basis for a deeper understanding of the M-CSF . c-FMS signaling mechanism
26245897 study shows up-regulation of MCSF in GBM via a SYK-PI3K-NFkappaB-dependent mechanism and identifies IGFBP1 released by microglial cells as a novel mediator of MCSF-induced angiogenesis
26235028 Data show crystal structures of CSF1-CSF1R ternary complexes, and propose a mechanism for their cooperative action that relies on the adoption by dimeric CSF-1 of an active conformational state and homotypic receptor interactions.
26095744 findings demonstrated that M-CSF binds to IL-34; molecular docking studies predicted the formation of a heteromeric M-CSF/IL-34 cytokine
26029847 These findings highlight an essential role for PRKAA1-mediated autophagy during differentiation of human monocytes.
25935153 These findings suggest a high usefulness of M-CSF in diagnosing the serous sub-type of epithelial ovarian cancer and in discriminating between cancer and non-carcinoma lesions
25891874 Our findings also suggest that next generation sequencing may help explore the pathogenesis and aid the diagnosis of Juvenile Paget's disease.
More...

AA Sequence

MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFV      1 - 70
DQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYE     71 - 140
TPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQP    141 - 210
LAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQP    211 - 280
RPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPL    281 - 350
PASAKGQQPADVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS    351 - 420
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSFS    421 - 490
PQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV          491 - 554
//

Text Mined References (209)

PMID Year Title
26686751 2016 3-D individual cell based computational modeling of tumor cell-macrophage paracrine signaling mediated by EGF and CSF-1 gradients.
26642091 2016 Injured sensory neuron-derived CSF1 induces microglial proliferation and DAP12-dependent pain.
26376111 2016 Monoclonal antibody against macrophage colony-stimulating factor suppresses circulating monocytes and tissue macrophage function but does not alter cell infiltration/activation in cutaneous lesions or clinical outcomes in patients with cutaneous lupus erythematosus.
26359491 2015 Combinatorial and Computational Approaches to Identify Interactions of Macrophage Colony-stimulating Factor (M-CSF) and Its Receptor c-FMS.
26245897 2015 Glioblastoma-derived Macrophage Colony-stimulating Factor (MCSF) Induces Microglial Release of Insulin-like Growth Factor-binding Protein 1 (IGFBP1) to Promote Angiogenesis.
26235028 2015 Structure and Assembly Mechanism of the Signaling Complex Mediated by Human CSF-1.
26095744 2015 IL-34 and M-CSF form a novel heteromeric cytokine and regulate the M-CSF receptor activation and localization.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26029847 2015 The PRKAA1/AMPK?1 pathway triggers autophagy during CSF1-induced human monocyte differentiation and is a potential target in CMML.
25935153 2015 M-CSF in a new biomarker panel with HE4 and CA 125 in the diagnostics of epithelial ovarian cancer patients.
More...