Property Summary

NCBI Gene PubMed Count 211
PubMed Score 1391.06
PubTator Score 1302.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -2.500 2.0e-06
adult high grade glioma 1.300 7.8e-04
COPD -1.200 3.4e-02
glioblastoma 1.500 7.6e-06
group 4 medulloblastoma -1.200 1.3e-04
lung cancer -4.300 4.9e-06
lung carcinoma -1.500 1.8e-11
medulloblastoma, large-cell 1.300 1.4e-04
Pilocytic astrocytoma 1.100 1.1e-03
psoriasis -1.200 3.1e-03

Protein-protein Interaction (2)

Gene RIF (161)

AA Sequence

MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFV      1 - 70
DQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYE     71 - 140
TPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQP    141 - 210
LAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQP    211 - 280
RPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPL    281 - 350
PASAKGQQPADVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS    351 - 420
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSFS    421 - 490
PQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV          491 - 554
//

Text Mined References (222)

PMID Year Title