Property Summary

NCBI Gene PubMed Count 826
PubMed Score 5707.94
PubTator Score 2639.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 2.49147129089811E-13
non-small cell lung cancer 2798 4.27884860941185E-10
malignant mesothelioma 3163 3.67755324173706E-8
psoriasis 6685 1.38028383607237E-7
cystic fibrosis 1670 1.30419979642157E-6
ulcerative colitis 2087 9.21233248546088E-6
posterior fossa group A ependymoma 1511 3.56340689731288E-5
acute quadriplegic myopathy 1157 3.62017769062133E-5
interstitial cystitis 2299 6.38269907071944E-5
ovarian cancer 8492 7.5077457530172E-5
pediatric high grade glioma 2712 1.24255393710492E-4
inflammatory breast cancer 404 1.78905533045875E-4
pilocytic astrocytoma 3086 4.85724857503513E-4
lung cancer 4473 5.52066936611743E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00310434109524641
glioblastoma 5572 0.00458743352137996
subependymal giant cell astrocytoma 2287 0.00810933905498821
active Crohn's disease 918 0.0276151449573113
aldosterone-producing adenoma 664 0.0351538380759972

Expression

  Differential Expression (19)

Synonym

Accession P09601 HO-1
Symbols HO-1
HSP32
HMOX1D
bK286B10

Gene

PANTHER Protein Class (2)

PDB

1N3U   1N45   1NI6   1OYK   1OYL   1OZE   1OZL   1OZR   1OZW   1S13   1S8C   1T5P   1TWN   1TWR   1XJZ   1XK0   1XK1   1XK2   1XK3   3CZY   3HOK   3K4F   3TGM   4WD4   5BTQ  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

 GWAS Trait (1)

Gene RIF (856)

PMID Text
27058954 evaluated Abeta-induced DNA methylation status of HMOX1 at -374 promoter CpG site in blood samples from Alzheimer disease patients, patients with mild cognitive impairment, and control individuals
27023064 These data suggest the role of Nrf2, HO-1 and glutathione as molecular targets to improve the efficacy of low doses of bortezomib in the treatment of malignant neuroblastoma.
26898422 HO-1, which is involved in the development of chemoresistance in leukemia cells by regulating autophagy, may be a novel target for improving leukemia therapy.
26822586 HO-1 inhibitor, ZnPP, possessed the properties of anti-tumor agent by decreasing HIF-1alpha levels, blocking VEGF production, impairing tumor angiogenesis, and inhibiting tumor growth.
26782424 Inhibited HO-1 expression attenuated the hypermethylation of CDKN2B by suppressing DNMT1, which was conducive to treatment by cooperating with decitabine.
26777482 overexpression in pig islets prolongs islet xenograft survival
26726846 High HO-1 expression was associated with poor prognosis of cholangiocarcinoma.
26700310 interleukin-6 and heme oxygenase-1 are involved in resistance to lenalidomide in multiple myeloma cells
26697129 This review focuses on the Nrf2/HO-1 stress response mechanism as a promising target for anticancer treatment which is able to overcome resistance to therapies.
26690352 HLA I Ab-dependent EC activation is modulated by endothelial HO-1 and targeted induction of this enzyme may be a novel therapeutic approach for the treatment of AMR in solid organ transplantation.
More...

AA Sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKE      1 - 70
SPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGD     71 - 140
LSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLN    141 - 210
IQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVAT    211 - 280
VAVGLYAM                                                                  281 - 288
//

Text Mined References (831)

PMID Year Title
27058954 2016 Amyloid Beta-Mediated Hypomethylation of Heme Oxygenase 1 Correlates with Cognitive Impairment in Alzheimer's Disease.
27023064 2016 Role of Nrf2, HO-1 and GSH in Neuroblastoma Cell Resistance to Bortezomib.
26898422 2016 Heme oxygenase-1 contributes to imatinib resistance by promoting autophagy in chronic myeloid leukemia through disrupting the mTOR signaling pathway.
26822586 2016 Blocking heme oxygenase-1 by zinc protoporphyrin reduces tumor hypoxia-mediated VEGF release and inhibits tumor angiogenesis as a potential therapeutic agent against colorectal cancer.
26782424 2015 Role of heme oxygenase-1 in demethylating effects on SKM-1 cells induced by decitabine.
26777482 2016 Beneficial effects of the transgenic expression of human sTNF-?R-Fc and HO-1 on pig-to-mouse islet xenograft survival.
26726846 2016 Haem oxygenase 1 expression is associated with prognosis in cholangiocarcinoma patients and with drug sensitivity in xenografted mice.
26700310 2016 Potential crosstalk of the interleukin-6-heme oxygenase-1-dependent mechanism involved in resistance to lenalidomide in multiple myeloma cells.
26697129 2016 The Nrf2/HO-1 Axis in Cancer Cell Growth and Chemoresistance.
26690352 2015 Heme Oxygenase-1 Inhibits HLA Class I Antibody-Dependent Endothelial Cell Activation.
More...