Property Summary

NCBI Gene PubMed Count 826
Grant Count 1,086
R01 Count 677
Funding $153,153,154.43
PubMed Score 5707.94
PubTator Score 2639.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (97)

Disease Z-score Confidence
Vascular disease 281 6.304 3.2
Toxic encephalopathy 131 4.834 2.4
Cancer 2,346 4.763 2.4
Kidney disease 396 4.613 2.3
diabetes mellitus 1,663 4.427 2.2
Parkinson's disease 364 4.136 2.1
Lung disease 132 4.071 2.0
Alzheimer's disease 644 4.052 2.0
Neonatal jaundice 15 3.928 2.0
Liver disease 219 3.867 1.9
Hyperglycemia 120 3.559 1.8
Malaria 140 3.547 1.8
Brain disease 83 3.534 1.8
Ureteral disease 23 3.391 1.7
Bilirubin metabolic disorder 39 3.306 1.7
Heart disease 279 3.282 1.6
Colitis 46 3.224 1.6
Arthritis 248 3.174 1.6
Asthma 349 3.173 1.6
Age related macular degeneration 84 3.146 1.6
Obesity 616 3.113 1.6
Gastroparesis 20 3.066 1.5
Acute kidney injury 65
Adrenoleukodystrophy 31
Adverse reaction to drug 54
Anemia, Hemolytic 12
Blood Coagulation Disorders 8
Cardiomegaly 66
Carotid Artery Diseases 11
Cerebral Hemorrhage 27
Chronic Obstructive Airway Disease 47
Contact Dermatitis 80
Coronary artery disease 240
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 157
Diabetic Angiopathies 7
Drug-Induced Liver Injury 118
Fibrosis 40
Growth Disorders 33
Heart failure 80
Heme Oxygenase 1 Deficiency 1
Hemolysis (disorder) 6
Hepatitis 61
Hepatorenal syndrome 5
Hyperinsulinism 63
Hyperplasia 26
Hypertensive disease 193
IGA Glomerulonephritis 454
Inflammation 109
Insulin Resistance 48
Iron Metabolism Disorders 5
Ischemia 27
Kidney Failure, Chronic 45
Learning Disorders 27
Leishmaniasis, Visceral 13
Liver Cirrhosis, Experimental 108
Liver diseases 66
Liver neoplasms 109
Lung Injury 20
Lung Neoplasms 171
Mammary Neoplasms 410
Mammary Neoplasms, Experimental 150
Mastocytosis, Systemic 2
Myocardial Ischemia 169
Neoplasm Invasiveness 127
Neurodegenerative Disorders 37
Pancreatic Diseases 6
Parkinson Disease 102
Pneumonia 133
Pulmonary Fibrosis 66
Pulmonary emphysema 34
Reperfusion Injury 84
Retinal Diseases 21
SPINOCEREBELLAR ATAXIA 17 9
Status Epilepticus 85
Stomach Neoplasms 282
Thrombosis 42
active Crohn's disease 918
acute quadriplegic myopathy 1,157
aldosterone-producing adenoma 664
cystic fibrosis 1,665
glioblastoma 5,572
inflammatory breast cancer 404
interstitial cystitis 2,299
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
non-small cell lung cancer 2,798
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
pre-eclampsia 67
psoriasis 6,685
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

  Differential Expression (19)

Synonym

Accession P09601 HO-1
Symbols HO-1
HSP32
HMOX1D
bK286B10

Gene

PANTHER Protein Class (2)

PDB

1N3U   1N45   1NI6   1OYK   1OYL   1OZE   1OZL   1OZR   1OZW   1S13   1S8C   1T5P   1TWN   1TWR   1XJZ   1XK0   1XK1   1XK2   1XK3   3CZY   3HOK   3K4F   3TGM   4WD4   5BTQ  

 GWAS Trait (1)

Gene RIF (856)

PMID Text
27058954 evaluated Abeta-induced DNA methylation status of HMOX1 at -374 promoter CpG site in blood samples from Alzheimer disease patients, patients with mild cognitive impairment, and control individuals
27023064 These data suggest the role of Nrf2, HO-1 and glutathione as molecular targets to improve the efficacy of low doses of bortezomib in the treatment of malignant neuroblastoma.
26898422 HO-1, which is involved in the development of chemoresistance in leukemia cells by regulating autophagy, may be a novel target for improving leukemia therapy.
26822586 HO-1 inhibitor, ZnPP, possessed the properties of anti-tumor agent by decreasing HIF-1alpha levels, blocking VEGF production, impairing tumor angiogenesis, and inhibiting tumor growth.
26782424 Inhibited HO-1 expression attenuated the hypermethylation of CDKN2B by suppressing DNMT1, which was conducive to treatment by cooperating with decitabine.
26777482 overexpression in pig islets prolongs islet xenograft survival
26726846 High HO-1 expression was associated with poor prognosis of cholangiocarcinoma.
26700310 interleukin-6 and heme oxygenase-1 are involved in resistance to lenalidomide in multiple myeloma cells
26697129 This review focuses on the Nrf2/HO-1 stress response mechanism as a promising target for anticancer treatment which is able to overcome resistance to therapies.
26690352 HLA I Ab-dependent EC activation is modulated by endothelial HO-1 and targeted induction of this enzyme may be a novel therapeutic approach for the treatment of AMR in solid organ transplantation.
More...

AA Sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKE      1 - 70
SPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGD     71 - 140
LSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLN    141 - 210
IQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVAT    211 - 280
VAVGLYAM                                                                  281 - 288
//

Text Mined References (831)

PMID Year Title
27058954 2016 Amyloid Beta-Mediated Hypomethylation of Heme Oxygenase 1 Correlates with Cognitive Impairment in Alzheimer's Disease.
27023064 2016 Role of Nrf2, HO-1 and GSH in Neuroblastoma Cell Resistance to Bortezomib.
26898422 2016 Heme oxygenase-1 contributes to imatinib resistance by promoting autophagy in chronic myeloid leukemia through disrupting the mTOR signaling pathway.
26822586 2016 Blocking heme oxygenase-1 by zinc protoporphyrin reduces tumor hypoxia-mediated VEGF release and inhibits tumor angiogenesis as a potential therapeutic agent against colorectal cancer.
26782424 2015 Role of heme oxygenase-1 in demethylating effects on SKM-1 cells induced by decitabine.
26777482 2016 Beneficial effects of the transgenic expression of human sTNF-?R-Fc and HO-1 on pig-to-mouse islet xenograft survival.
26726846 2016 Haem oxygenase 1 expression is associated with prognosis in cholangiocarcinoma patients and with drug sensitivity in xenografted mice.
26700310 2016 Potential crosstalk of the interleukin-6-heme oxygenase-1-dependent mechanism involved in resistance to lenalidomide in multiple myeloma cells.
26697129 2016 The Nrf2/HO-1 Axis in Cancer Cell Growth and Chemoresistance.
26690352 2015 Heme Oxygenase-1 Inhibits HLA Class I Antibody-Dependent Endothelial Cell Activation.
More...