| Tbio | Heme oxygenase 1 |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq, Jul 2008]
Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| lung carcinoma | 2843 | 2.5e-13 |
| non-small cell lung cancer | 2890 | 4.3e-10 |
| malignant mesothelioma | 3232 | 3.7e-08 |
| psoriasis | 6694 | 1.4e-07 |
| cystic fibrosis | 1696 | 1.3e-06 |
| ulcerative colitis | 1819 | 9.2e-06 |
| acute quadriplegic myopathy | 1158 | 3.6e-05 |
| ovarian cancer | 8520 | 7.5e-05 |
| glioblastoma | 5792 | 2.5e-04 |
| Astrocytoma, Pilocytic | 3081 | 4.4e-04 |
| lung cancer | 4740 | 5.5e-04 |
| Breast cancer | 3578 | 7.9e-04 |
| pancreatic ductal adenocarcinoma liver metastasis | 1962 | 3.1e-03 |
| interstitial cystitis | 2312 | 3.3e-03 |
| ependymoma | 4679 | 5.1e-03 |
| subependymal giant cell astrocytoma | 2287 | 8.1e-03 |
| adult high grade glioma | 3801 | 2.0e-02 |
| active Crohn's disease | 922 | 2.8e-02 |
| aldosterone-producing adenoma | 665 | 3.5e-02 |
| Disease | Target Count |
|---|---|
| COPD | 118 |
| Congestive heart failure | 113 |
| Disease | log2 FC | p |
|---|---|---|
| active Crohn's disease | -1.200 | 2.8e-02 |
| acute quadriplegic myopathy | 1.156 | 3.6e-05 |
| adult high grade glioma | 1.300 | 2.0e-02 |
| aldosterone-producing adenoma | -1.283 | 3.5e-02 |
| Astrocytoma, Pilocytic | 1.300 | 4.4e-04 |
| Breast cancer | 1.400 | 7.9e-04 |
| cystic fibrosis | 1.682 | 1.3e-06 |
| ependymoma | 1.100 | 5.1e-03 |
| glioblastoma | 1.800 | 2.5e-04 |
| interstitial cystitis | 1.600 | 3.3e-03 |
| lung cancer | -1.200 | 5.5e-04 |
| lung carcinoma | -1.200 | 2.5e-13 |
| malignant mesothelioma | -2.600 | 3.7e-08 |
| non-small cell lung cancer | -1.621 | 4.3e-10 |
| ovarian cancer | -1.200 | 7.5e-05 |
| pancreatic ductal adenocarcinoma liver m... | -2.163 | 3.1e-03 |
| psoriasis | 1.400 | 1.4e-07 |
| subependymal giant cell astrocytoma | 2.408 | 8.1e-03 |
| ulcerative colitis | -1.700 | 9.2e-06 |
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKE 1 - 70 SPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGD 71 - 140 LSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLN 141 - 210 IQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVAT 211 - 280 VAVGLYAM 281 - 288 //
