Tbio | Heme oxygenase 1 |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq, Jul 2008]
Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
lung carcinoma | 2844 | 2.49147129089811E-13 |
non-small cell lung cancer | 2798 | 4.27884860941185E-10 |
malignant mesothelioma | 3163 | 3.67755324173706E-8 |
psoriasis | 6685 | 1.38028383607237E-7 |
cystic fibrosis | 1670 | 1.30419979642157E-6 |
ulcerative colitis | 2087 | 9.21233248546088E-6 |
posterior fossa group A ependymoma | 1511 | 3.56340689731288E-5 |
acute quadriplegic myopathy | 1157 | 3.62017769062133E-5 |
interstitial cystitis | 2299 | 6.38269907071944E-5 |
ovarian cancer | 8492 | 7.5077457530172E-5 |
pediatric high grade glioma | 2712 | 1.24255393710492E-4 |
inflammatory breast cancer | 404 | 1.78905533045875E-4 |
pilocytic astrocytoma | 3086 | 4.85724857503513E-4 |
lung cancer | 4473 | 5.52066936611743E-4 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 0.00310434109524641 |
glioblastoma | 5572 | 0.00458743352137996 |
subependymal giant cell astrocytoma | 2287 | 0.00810933905498821 |
active Crohn's disease | 918 | 0.0276151449573113 |
aldosterone-producing adenoma | 664 | 0.0351538380759972 |
Disease | Target Count |
---|---|
COPD | 116 |
Congestive heart failure | 36 |
Heme oxygenase 1 deficiency | 1 |
Pulmonary emphysema | 34 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | -2.600 | 0.000 |
psoriasis | 1.400 | 0.000 |
glioblastoma | 2.600 | 0.005 |
posterior fossa group A ependymoma | 1.700 | 0.000 |
cystic fibrosis | 1.682 | 0.000 |
acute quadriplegic myopathy | 1.156 | 0.000 |
pancreatic ductal adenocarcinoma liver m... | -2.163 | 0.003 |
non-small cell lung cancer | -1.621 | 0.000 |
lung cancer | -1.200 | 0.001 |
active Crohn's disease | -1.200 | 0.028 |
interstitial cystitis | 1.800 | 0.000 |
pediatric high grade glioma | 2.200 | 0.000 |
pilocytic astrocytoma | 1.300 | 0.000 |
aldosterone-producing adenoma | -1.283 | 0.035 |
subependymal giant cell astrocytoma | 2.408 | 0.008 |
inflammatory breast cancer | 2.200 | 0.000 |
lung carcinoma | -1.200 | 0.000 |
ulcerative colitis | -1.700 | 0.000 |
ovarian cancer | -1.200 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA EggNOG |
PMID | Text |
---|---|
27058954 | evaluated Abeta-induced DNA methylation status of HMOX1 at -374 promoter CpG site in blood samples from Alzheimer disease patients, patients with mild cognitive impairment, and control individuals |
27023064 | These data suggest the role of Nrf2, HO-1 and glutathione as molecular targets to improve the efficacy of low doses of bortezomib in the treatment of malignant neuroblastoma. |
26898422 | HO-1, which is involved in the development of chemoresistance in leukemia cells by regulating autophagy, may be a novel target for improving leukemia therapy. |
26822586 | HO-1 inhibitor, ZnPP, possessed the properties of anti-tumor agent by decreasing HIF-1alpha levels, blocking VEGF production, impairing tumor angiogenesis, and inhibiting tumor growth. |
26782424 | Inhibited HO-1 expression attenuated the hypermethylation of CDKN2B by suppressing DNMT1, which was conducive to treatment by cooperating with decitabine. |
26777482 | overexpression in pig islets prolongs islet xenograft survival |
26726846 | High HO-1 expression was associated with poor prognosis of cholangiocarcinoma. |
26700310 | interleukin-6 and heme oxygenase-1 are involved in resistance to lenalidomide in multiple myeloma cells |
26697129 | This review focuses on the Nrf2/HO-1 stress response mechanism as a promising target for anticancer treatment which is able to overcome resistance to therapies. |
26690352 | HLA I Ab-dependent EC activation is modulated by endothelial HO-1 and targeted induction of this enzyme may be a novel therapeutic approach for the treatment of AMR in solid organ transplantation. |
More... |
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKE 1 - 70 SPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGD 71 - 140 LSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLN 141 - 210 IQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVAT 211 - 280 VAVGLYAM 281 - 288 //
PMID | Year | Title |
---|---|---|
27058954 | 2016 | Amyloid Beta-Mediated Hypomethylation of Heme Oxygenase 1 Correlates with Cognitive Impairment in Alzheimer's Disease. |
27023064 | 2016 | Role of Nrf2, HO-1 and GSH in Neuroblastoma Cell Resistance to Bortezomib. |
26898422 | 2016 | Heme oxygenase-1 contributes to imatinib resistance by promoting autophagy in chronic myeloid leukemia through disrupting the mTOR signaling pathway. |
26822586 | 2016 | Blocking heme oxygenase-1 by zinc protoporphyrin reduces tumor hypoxia-mediated VEGF release and inhibits tumor angiogenesis as a potential therapeutic agent against colorectal cancer. |
26782424 | 2015 | Role of heme oxygenase-1 in demethylating effects on SKM-1 cells induced by decitabine. |
26777482 | 2016 | Beneficial effects of the transgenic expression of human sTNF-?R-Fc and HO-1 on pig-to-mouse islet xenograft survival. |
26726846 | 2016 | Haem oxygenase 1 expression is associated with prognosis in cholangiocarcinoma patients and with drug sensitivity in xenografted mice. |
26700310 | 2016 | Potential crosstalk of the interleukin-6-heme oxygenase-1-dependent mechanism involved in resistance to lenalidomide in multiple myeloma cells. |
26697129 | 2016 | The Nrf2/HO-1 Axis in Cancer Cell Growth and Chemoresistance. |
26690352 | 2015 | Heme Oxygenase-1 Inhibits HLA Class I Antibody-Dependent Endothelial Cell Activation. |
More... |